KEGG   Acidovorax avenae: Acav_0404Help
Entry
Acav_0404         CDS       T01445                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
aaa  Acidovorax avenae
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:aaa03012]
    Acav_0404
   03029 Mitochondrial biogenesis [BR:aaa03029]
    Acav_0404
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aaa04147]
    Acav_0404
Translation factors [BR:aaa03012]
 Eukaryotic Type
  Elongation factors
   Acav_0404
 Prokaryotic Type
   Acav_0404
Mitochondrial biogenesis [BR:aaa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Acav_0404
Exosome [BR:aaa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Acav_0404
  Exosomal proteins of breast cancer cells
   Acav_0404
  Exosomal proteins of colorectal cancer cells
   Acav_0404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: ADX44327
UniProt: F0Q4F6
LinkDB All DBs
Position
446929..448119
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSAKFGGEAKKYDEIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLDKYDFPGDDTPIVRGSAKLALE
GDKGPLGEQAIDKLAEALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGIIK
VGEEIEIVGIRDTQKTTCTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGAIELPADKEMVMPGDNVS
ITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKIIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaagttcgaacgtaccaagccccacgtgaacgtgggcacgatcggccac
gtggaccatggcaagacgacgctgacggcagcgatcgccacggtgctgtccgccaagttc
ggcggcgaagccaagaagtacgacgaaatcgacgcagcgcccgaagaaaaggcccgcggc
atcaccatcaacactgcacacgtggaatacgagacggccaaccgccactacgcccacgtg
gactgccccggccacgccgactacgtcaagaacatgatcaccggtgccgcccagatggac
ggcgccatcctggtgtgctcggccgccgacggcccgatgccccagacgcgcgagcacatc
ctgctggcccgccaggtgggcgtgccctacatcatcgtgttcctgaacaagtgcgacatg
gtggatgacgaagagctgctcgagctcgtcgaaatggaagtgcgcgaactcctcgacaag
tacgacttccccggcgacgacacccccatcgtgcgcggctcggccaagctggccctcgaa
ggcgacaagggccccctgggcgagcaagccatcgacaagctggctgaagccctggacacc
tacatcccgacgcccgagcgcgccgtggacggtgccttcctgatgcccgtggaagacgtg
ttctccatctccggtcgcggtaccgtggtgacgggtcgtgtcgagcgcggcatcatcaag
gtcggcgaagaaatcgaaatcgtgggtatccgcgacacgcagaagaccacctgcacgggc
gtggaaatgttccgcaagctgctggaccagggccaggccggcgacaacgtgggcctgctg
ctgcgcggcacgaagcgtgaagacgtcgagcgcggccaggtgctgtgcaagcccggctcc
atcaagccgcacacccacttcacggctgaggtgtacgtgctgtcgaaggacgaaggcggc
cgccacacgcccttcttcaacaactaccgcccgcagttctacttccgcacgaccgatgtg
accggcgccatcgagctgccggccgacaaggaaatggtcatgcccggcgacaacgtgtcg
atcaccgtcaagctgatcaaccccatcgccatggaagaaggcctgcgcttcgccatccgc
gaaggcggccgtacggtcggcgccggcgtcgtggccaagatcattgcttaa

DBGET integrated database retrieval system