KEGG   Acidovorax avenae: Acav_0572Help
Entry
Acav_0572         CDS       T01445                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
aaa  Acidovorax avenae
Pathway
aaa00330  Arginine and proline metabolism
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01130  Biosynthesis of antibiotics
aaa01230  Biosynthesis of amino acids
Module
aaa_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Acav_0572
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     Acav_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ADX44495
UniProt: F0Q667
LinkDB All DBs
Position
complement(617833..618675)
Genome map
AA seq 280 aa AA seqDB search
MTPDTPLPASDQSAIAFIGGGNMASAIIGGLIRQGMPASAIEVVEPWEEARAALRAHHGI
EALPEAGTALERAGVVVWAVKPQTFKEAAQQARPYTANAVHLSVAAGIRSDSIAAWLGSE
CVVRAMPNTPALIGRGMTALYARPQVSPAQRAAVQQVLASTGELLWVDEEPQLDAVTALS
GSGPAYVFLFLEAMAQAGVEMGLAPEQAHQLAVGTFTGASELARRSDESPAVLRQRVTSK
GGTTFAAVQSMEQAGLPEQFIRAMKAAQARARELGDEFGR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgacacccccctccccgcatccgaccaatccgcgatcgccttcatcggcggc
ggcaacatggccagcgccatcatcggcggactgatccggcagggcatgccggcctccgcc
atcgaggtggtcgagccctgggaggaagcgcgggccgccctgcgcgcgcaccacggcatc
gaggccctgccggaggccgggacggccctggagcgcgccggcgtggtggtgtgggctgtc
aagccccagacgttcaaggaggccgcgcagcaggcacgcccctacacggcgaatgcggtg
cacctcagcgtggccgccgggatccggtcggatagcatcgccgcctggctgggctcggaa
tgcgtggtgcgcgccatgcccaacacgcctgcgctgatcggacgcggcatgacggcgctg
tatgcccgcccgcaggtgagccccgcgcagcgcgccgccgtgcagcaggtgctggcgtcc
acgggcgagctgctctgggtggacgaggagccgcagctcgacgccgtgaccgcgctgtcg
ggatcgggcccggcctatgtcttcctgttcctggaggcgatggcgcaggcgggggtggag
atgggcctcgcgcccgagcaggcgcaccagctggccgtgggcacgttcacgggggcgtcg
gaactggcgcgccgctcggacgaatcgcccgcggtgctgcgccagcgcgtgacctccaag
ggcggcaccaccttcgcggccgtccagtcgatggagcaggccggcctgccggagcagttc
atccgcgcgatgaaggccgcgcaggcacgggcccgcgaactgggagacgagttcggaagg
tga

DBGET integrated database retrieval system