KEGG   Acidovorax avenae: Acav_0581Help
Entry
Acav_0581         CDS       T01445                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aaa  Acidovorax avenae
Pathway
aaa00564  Glycerophospholipid metabolism
aaa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Acav_0581
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Acav_0581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 HI0933_like Lycopene_cycl GIDA 3HCDH_N Pyr_redox_3 Pyr_redox Thi4
Motif
Other DBs
NCBI-ProteinID: ADX44504
UniProt: F0Q676
LinkDB All DBs
Position
627766..629358
Genome map
AA seq 530 aa AA seqDB search
MTSPNTPQPTVRAQLLARLAEPRQYDLAVIGGGATGLGVALDAAARGFSVVLVESHDFAK
GTSSRATKLVHGGVRYLAQGNISLVREALHERTTLLGNAPHLAQPLPFVMPSYHLWETPF
YGVGLKAYDLLAGRAGLGATEFLGREGTLRLLPTVRREGLRGGVKYWDGQFDDARLALAL
ARTAALRGALLVNYCPARELIHEDGKVAGLHCEDVETGTRYTVRARCVVNATGVWVDGLL
RQDAEALGRPAKPIVAPSQGVHIVVDREFLPSDHAMMVPKTADGRVLFAVPWLGKIILGT
TDSPRQDLEREPLPFREEADFILSESARYLTRAPSASDVRSIWVGLRPLVRPPDDEGGST
KGISREHTVLASPSGLVTVTGGKWTTYRAMAEDVLQKCFDAGLLAARAGGVTQRLPVVGS
PQGAVRHGMDEAQGPHSYGSEAEFLDTVPGAQRWLAPGLSEAMVRFAARHEYARTVEDML
SRRSRMLFLDAARALAIAPDVARILQEELGRDPALAAFEALAAQYLSVPR
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgacctccccgaacacgccccagcctaccgtgcgcgcccagctcctggcgcggcttgcc
gagcctcggcagtacgacctggcggtcatcgggggcggtgccacggggctcggcgtggcg
ctcgacgctgccgcgcgcggcttcagcgtcgtgctcgtggaatcccatgacttcgccaag
ggcacctcgtcgcgcgccaccaagctggtgcacggcggcgtccgctacctggcccagggc
aacatctccctggtgcgcgaggcgctccacgaacgcacgaccctgctgggcaatgcgccc
cacctggcccagcccctgccgttcgtcatgccctcctaccacctgtgggagacgccgttc
tacggagtgggcctgaaggcctatgacctgctggcgggccgagccggcctgggtgccacc
gaattcctcggccgcgaaggcaccctgcgcctgctgcccaccgtgcggcgcgaagggctg
cggggcggcgtcaagtactgggacggccagttcgacgacgcccggctggcgctggcgctg
gcgcgcacggccgcgctccgcggcgcgctgctggtcaactattgccccgcccgcgagctc
atccatgaagacggcaaggtggcgggcctgcactgcgaggacgtggaaaccggcacccgc
tataccgtacgcgcgcgctgcgtggtcaacgcgaccggcgtgtgggtggacgggctgctg
cgccaggacgccgaagcgctcggccgtccggccaagcccatcgtggcccccagccagggc
gtacacatcgtcgtggaccgggagttcctgccctccgaccatgccatgatggtccccaag
acggccgatggccgcgtcctcttcgccgtgccctggctcggaaagatcatcctcgggacc
accgacagcccccggcaggacctcgaacgcgaacccctgccgttccgcgaagaggccgat
ttcatcctgagcgagtcggcccgctacctcacccgcgcgccttccgcgtcggacgtgcgc
agcatctgggtgggcctgcgccccctggtccggccgccggacgacgagggaggcagcacc
aagggcatcagccgcgagcacaccgtgctggccagccccagcggactggtcaccgtgacg
ggcggcaaatggaccacctaccgcgccatggcggaggacgtgttgcaaaaatgcttcgat
gccggcctgctcgcggcccgcgccggcggcgtcacccagcgactgccggtggtgggttcc
ccccagggtgccgttcggcacgggatggacgaggcccaggggccgcattcctacggttcg
gaggcggagttcctggataccgtgcccggtgcccagcgctggctggcgccggggctgtcg
gaggccatggtccgcttcgccgcacgccatgagtacgcccgcacggtcgaggacatgctc
tcgcggcgcagccggatgctgttcctcgatgccgcccgcgccctcgcgatcgcccccgac
gtggcccggatcctccaggaggagctgggcagggaccccgcgctcgccgccttcgaggcc
ctggcggcgcagtacctctcggtgccccgctaa

DBGET integrated database retrieval system