KEGG   Acidovorax avenae: Acav_1410Help
Entry
Acav_1410         CDS       T01445                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aaa  Acidovorax avenae
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Acav_1410
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Acav_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_oxidored GIDA FAD_binding_2 DAO Glutaredoxin HI0933_like FAD_binding_3 AlaDh_PNT_C NAD_binding_7 Thi4 K_oxygenase FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADX45332
UniProt: F0Q260
LinkDB All DBs
Position
1559940..1561508
Genome map
AA seq 522 aa AA seqDB search
MLDDQLKSQLSAYLERVTQSFEIVASLDGSETSVQMRDLLETIQSLRSDRISLRTDGNDA
RKPSFTLQRAGTQTSLRFAGLPLGHEFTSLVLALLWTGGHPPKVEQDVIEQVQALDGDFD
FEVYMSLTCHNCPDVVQALSLMAILNPRIRTTVIEGGAFQQEVTDREIMAVPMVFLNGQV
FGSGRMTIEEIVGKLDTGAAKREAARLSAKEAFDVLIVGGGPAGAAAAVYAARKGIRTGI
AAERFGGQVNDTLDIENYISVSKTDGPKFAAALEQHVRDYEVDLMNLQRARALRPAATEG
GLIEVELENGGTLSSRTVIISTGARWRNMNVPGEEQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVAHVTVLEFAGELKADAVLQRKLRSLPNVDVILNAQTTEVKGD
GNRVTGLSYKDRTNDEHHVLALEGIFVQIGLLPNTDWLKGTVDLSRFGEIVVDSHGRTSV
PGVFAAGDCTTVPYKQIIIAAGEGAKAALGAFDHLIRTTAPA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgaccaactcaaatcccaactttccgcctatctggagcgcgtgacgcagtcg
ttcgagatcgtggcgtcgctggacggcagcgagacctccgtgcagatgcgcgacctgctg
gaaaccatccagtccctgcgcagcgacaggatcagcctgcgcaccgacggcaacgatgcc
cgcaagccgtccttcactctgcagcgtgccggcacgcagacgagcctgcgcttcgccggc
ctgccgctcggccatgaattcacctcgctcgtgctggcgctgctctggacgggcggccac
ccgccgaaggtggagcaggacgtgatcgagcaggtgcaggcgctcgacggcgacttcgac
ttcgaggtgtacatgagcctgacgtgccacaactgcccggacgtggtgcaggcgctgtcg
ctcatggccatcctcaacccccgcatccgcaccaccgtgatcgagggcggcgccttccag
caggaagtgaccgaccgcgagatcatggccgtgcccatggtcttcctcaacggccaggtg
ttcggctccggccgcatgaccatcgaggaaatcgtcggcaagctcgacaccggcgccgcg
aagcgcgaagccgccaggctgtccgcgaaggaagcgttcgacgtgctgatcgtcggcggt
ggcccggcaggtgccgcggcggccgtgtacgccgcccgcaagggcatccgcaccggcatc
gcggccgagcgcttcggcggccaggtgaacgacacgctggacatcgagaactacatctcg
gtcagcaagaccgacggcccgaagttcgccgccgcgctggagcagcacgtgcgcgactac
gaggtggacctgatgaacctgcagcgcgcccgcgcgctccggcccgctgccaccgaaggc
ggcctgatcgaggtcgagctggagaacggcggcacgctctcgtcccgcaccgtgatcatt
tccaccggtgcacgctggcgcaacatgaacgtgccgggcgaggagcagtaccgcaccaag
ggcgtgacctactgcccgcactgcgacggcccgctcttcaagggcaagcgcgtggcggtg
atcggcggcggcaactccggcgtggaggccgcgatcgacctggccggcgtggtggcccac
gtcaccgtgctcgaattcgcgggcgagctgaaggccgacgccgtgctgcagcgcaagctg
cgcagcctgccgaacgtggacgtgatcctcaacgcgcagaccaccgaggtgaagggcgac
ggcaaccgcgtgaccggcctgagctacaaggaccgcacgaacgacgagcaccatgtgctc
gccctggaaggcatcttcgtgcagatcggcctgctgcccaacaccgactggctcaagggc
acggtggacctgtcgcgcttcggcgagatcgtggtggactcccacggccgcaccagcgtg
ccgggcgtgttcgcggccggcgactgcaccacggtgccctacaagcagatcatcatcgcg
gccggcgagggcgcgaaggcggcgctgggcgcgttcgaccacctgatccgcacgaccgcc
ccggcctga

DBGET integrated database retrieval system