KEGG   Acidovorax avenae: Acav_3608Help
Entry
Acav_3608         CDS       T01445                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K03599  stringent starvation protein A
Organism
aaa  Acidovorax avenae
Brite
KEGG Orthology (KO) [BR:aaa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aaa03021]
    Acav_3608
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aaa02000]
    Acav_3608
Transcription machinery [BR:aaa03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     Acav_3608
Transporters [BR:aaa02000]
 Other transporters
  Pores ion channels [TC:1]
   Acav_3608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 Glutaredoxin GST_C_3 GST_C_5
Motif
Other DBs
NCBI-ProteinID: ADX47507
UniProt: F0QCM4
LinkDB All DBs
Position
complement(4086297..4086908)
Genome map
AA seq 203 aa AA seqDB search
MMVLYSGTTCPFSHRCRFVLFEKGMDFEIRDVDLYNKPEDISVMNPYGQVPILVERDLIL
YESNIINEYIDERFPHPQLMPGDPVDRARVRLFLLNFEKELFVHVNVLESRATKGNEKAL
EKARSHIRDRLTQLAPVFLKNKYMLGENFSMLDVAIAPLLWRLDYYGIELSKNAAPLLKY
AERIFSRPAYIEALTPSEKVMRK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgctttattcgggtacgacctgtcccttctcccatcgctgccgcttcgtgctg
ttcgaaaaaggcatggatttcgagatccgtgatgtggacctgtacaacaagcccgaagac
atcagcgtgatgaacccctatggccaggtgcccatcctggtcgagcgcgacctcatcctg
tacgagtcgaacatcatcaacgagtacatcgacgagcgcttcccgcatccccagctgatg
cccggcgacccggtggaccgcgcccgcgtgcgcctgttcctgctcaacttcgagaaggag
ctgttcgtccacgtgaacgtgctcgagtcgcgcgccaccaagggcaacgaaaaggcgctg
gaaaaggcccgctcgcacatccgcgaccgcctcacgcagctcgccccggtgttcctcaag
aacaagtacatgctgggcgagaacttctccatgctcgacgtggcgatcgcgccgttgctc
tggcggctcgactactacggcatcgagttgtccaagaacgccgcaccgctgctgaagtat
gccgagcgcatcttctcgcgccccgcctacatcgaggcgctcacgccttccgagaaggtc
atgcgcaagtaa

DBGET integrated database retrieval system