KEGG   Amycolatopsis albispora: A4R43_03205
Entry
A4R43_03205       CDS       T05547                                 

Definition
(GenBank) cephalosporin hydroxylase
  KO
K12744  deacetoxycephalosporin-C synthase [EC:1.14.20.1]
Organism
aab  Amycolatopsis albispora
Pathway
aab00311  Penicillin and cephalosporin biosynthesis
aab01100  Metabolic pathways
aab01110  Biosynthesis of secondary metabolites
Module
aab_M00673  Cephamycin C biosynthesis, aminoadipate + cycteine + valine => cephamycin C
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    A4R43_03205
Enzymes [BR:aab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.1  deacetoxycephalosporin-C synthase
     A4R43_03205
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N PSD2
Other DBs
NCBI-ProteinID: AXB41648
UniProt: A0A344L0S4
LinkDB
Position
complement(643033..643974)
AA seq 313 aa
MTDATVPTFDLTELRAGRHQDEFRRCLREKGVFYLEGTGLTEADHAPAREIAVDFFDHGT
EAEKKAVMTPIPTIRRGYAGLESESTAQITNTGKYTDYSMSYSMGTADNLFPSPEFERAW
EEYFARMYRASREVARQVLNTAGAEPEGGMDAFLDCEPLLRLRYFPEVPEDRVAEEEPLR
MAPHYDLSIVTLIHQTPCANGFVSLQVEVDGSVVDLPARPGAVLVFCGAVATLVADGRIK
APKHHVAAPGAGERVGSSRTSSVFFLRPNGDFRFSVPRARECGFDVTIPAETATFNDWIG
GNYINIRKTAAAR
NT seq 942 nt   +upstreamnt  +downstreamnt
atgacggacgcgaccgtacccaccttcgacctgaccgagctgcgcgcgggacggcaccag
gacgagttccgccgctgcctccgcgaaaagggggtcttctacctcgagggcaccgggctc
accgaggccgaccacgccccggcgcgcgagatcgcggtggacttcttcgaccacggcacc
gaagccgagaagaaggcggtgatgaccccgattccgaccatccggcgcgggtacgccggg
ctggagtcggagagcaccgcgcagatcaccaacaccggcaagtacaccgactactcgatg
tcgtactcgatgggcaccgcggacaacctgttcccgtcgccggagttcgagcgggcgtgg
gaggagtacttcgcccggatgtaccgggcttcgcgggaggtcgcgaggcaggtgctgaac
accgcgggcgcggaaccggagggcggcatggacgccttcctcgactgcgagccgctgctc
cggctgcggtacttccccgaggtccccgaagaccgcgtggccgaggaggagccgctgcgg
atggcaccgcactacgacctctcgatcgtcaccctgatccaccagaccccgtgcgcgaac
gggttcgtcagcctccaggtcgaagtcgacgggtccgttgtggacctgccggcgcgcccg
ggcgcggtgctggtcttctgcggcgcggtggccacgctggtggccgacggccggatcaag
gcgcccaagcaccacgtggccgcgccgggcgcgggcgagcgggtgggcagcagccgcacc
tccagcgtgttcttcctgcgccccaacggggatttccggttctccgtgcccagggccagg
gagtgcgggttcgacgtcaccattcccgccgagacggccaccttcaacgactggatcggc
ggcaactacatcaacatccggaagaccgccgccgcgcggtga

DBGET integrated database retrieval system