KEGG   Amycolatopsis albispora: A4R43_06760Help
Entry
A4R43_06760       CDS       T05547                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
aab  Amycolatopsis albispora
Pathway
aab00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A4R43_06760
Enzymes [BR:aab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     A4R43_06760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4350 Glyco_hydro_14 Glyco_hydro_35 DUF3459
Motif
Other DBs
NCBI-ProteinID: AXB42268
UniProt: A0A344L2J4
LinkDB All DBs
Position
complement(1413487..1415487)
Genome map
AA seq 666 aa AA seqDB search
MFGKIHYGADYNPEHWSAEVWDEDIKLMAESGVTMVTAGIFSWAGVEPRPGEYDFGWFDT
VMDKLGDARVEVCLATMTASPPPWLTHLHPEVLPVRADGTRLSAGARQQFCPSSEVFRRY
AARLAEQVARRYGDHPALSMWHIGNEYGCHIRACYCDNSAADFRRWLADRYGDIAALNQA
WSTTFWSQQYDDWAEVFPPRVAPTFPNPAQQLDFHRFSSDASLGCYLAEQKVLRRLTPDV
PITTNFVGRVQKSLDWHRWVPHEDVVSLDSYPDPYDPRSHVEAAFAYDLVRSLKHGKPWM
LLEQAPSAVNWRNRNSPKAPGAMRLGSWQAVAGGADAILFFQWRQTSGGAEKFHSAMVPH
GGRETRTWREVSALGQELATVSELAGTTIDADVAVLHDWESWWGLELDSHPSGDLDQLET
HLAHYAPLFDAGITCDVRHPSDDLSKYKLVVVPNLYLMDESVAANLRRYVERGGHLVVSF
FSGIVDACDRAYLGGYPAPLRDILGLRVDEFWPLPDGGTTTVRFADGTETGATVWSEWIE
LEGAEVIGSFAGGELAGRPAVTRHGFGEGVAWYLATRPDAGGMRALFDRITAEASATPVL
PGLPEGVQAVVRRGTDREYLMLLNHTTSEVTVPLPSAAADLLTDAGTPLDEVVLGSRGVA
VLRRNS
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgttcgggaagatccattacggggccgactacaaccccgagcactggtcggccgaggtg
tgggacgaagacatcaagctgatggccgagtccggggtgaccatggtgaccgcgggtatc
ttctcgtgggccggggtcgaaccgcggccgggtgagtacgacttcggctggttcgacacg
gtgatggacaagctcggtgacgcacgcgtcgaggtctgcctggccacgatgaccgcctct
cccccgccgtggctgacccacctgcaccccgaagtcctgccggtgcgggccgacggcacg
cggctgtcggccggggcacgccagcagttctgcccgtccagcgaggtgttccgccgttac
gccgccaggctggccgagcaggtggcccggcggtacggcgaccacccggcgctgtcgatg
tggcacatcggcaacgagtacggctgccacatccgcgcctgctactgcgacaactcggcg
gcggacttccggcgctggctggccgaccggtacggcgacatcgccgcgctgaaccaggcg
tggagcaccaccttctggtcgcagcagtacgacgactgggccgaggtcttcccgccacgc
gtggcgccgaccttcccgaacccggcgcagcagctggacttccaccggttctcctccgac
gcctcgctcggctgctacctggccgagcagaaggtgctgcggcggctcaccccggacgtg
ccgatcaccacgaacttcgtcggccgggtgcagaagtcgctggactggcaccgctgggtg
ccgcacgaggacgtggtcagcctcgactcctaccccgacccctacgacccgcgttcccac
gtcgaggccgccttcgcctacgacctggtgcgctcgctgaagcacggcaagccgtggatg
ctgctggagcaggcacccagcgcggtgaactggcgcaaccgcaacagccccaaggcgccc
ggcgcgatgcggctgggcagttggcaggcggtggcgggcggggccgacgcgatcctgttc
ttccagtggcgccagaccagcggcggcgccgagaagttccactcggcgatggtgccgcac
ggtggccgtgaaacgcgcacctggcgcgaagtcagcgcgctcggccaggagctggcgacg
gtgtcggagctggcgggcaccacgatcgacgcggacgtggcggtcctgcacgactgggaa
agctggtggggcctcgagctggactcgcacccctccggtgacctggaccagctcgaaacg
cacctcgcgcactacgcgccgctgttcgacgccgggatcacctgcgacgtgcggcacccg
tcggacgacctgtcgaagtacaagctcgtcgtggtgccgaacctctacctgatggacgag
tcggtggcggcgaacctgcgccggtacgtcgaacgcggcgggcacctggtggtgtcgttc
ttctccggcatcgtggacgcctgcgaccgcgcgtacctcggcggttatccggcgccgctg
cgggacatcctcggcctgcgcgtggacgagttctggccgctgccggacggcggcacgacc
acggtccggttcgccgacggcaccgaaaccggggcgacggtgtggtcggaatggatcgaa
ctcgaaggcgccgaggtgatcggctcgttcgccggcggtgagctggccgggcgcccggcg
gtgacccggcacggcttcggcgaaggcgtggcgtggtacctggcgacccggcccgacgcc
ggcggcatgcgtgcgttgttcgaccgcatcaccgccgaggcttcggcgacaccggtgctg
ccgggactgcccgaaggcgtgcaggcggtggtccgccgtggcaccgaccgcgagtacctg
atgctgctcaaccacaccacgtcggaggtcaccgtgccgttgccgtcggccgcagccgat
ctgctcaccgatgccgggacgccgctcgacgaggttgtgctcggttcgcgtggggtggcc
gtgctgaggaggaactcgtga

DBGET integrated database retrieval system