KEGG   Amycolatopsis albispora: A4R43_07925Help
Entry
A4R43_07925       CDS       T05547                                 

Definition
(GenBank) hypothetical protein
Organism
aab  Amycolatopsis albispora
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 PS-DH KR Ketoacyl-synt_C KAsynt_C_assoc PP-binding adh_short Epimerase Docking Thiolase_N adh_short_C2 Polysacc_synt_2 SAT GDP_Man_Dehyd ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AXB42464
UniProt: A0A344L340
LinkDB All DBs
Position
1680892..1686243
Genome map
AA seq 1783 aa AA seqDB search
MADKMTEAKLLDHLKWMTGELRQTRRQLGEAEARDREPIAIVAMSCRFPGGVTSPDELWE
LVSAGRDAVTGFPRDRGWDVDGLYDPDPDRPGTSYVREGGFIEGAADFDPAFFGISPREA
LATDPQQRLVLETSWEAFERAGIDPATLNGSSTGVFVGCSGQEYTSMAAQTSNDLASYVV
SGTAPSVVSGRVAYVLGLTGPALTIDTACSSSLVALHLAARSLRSGECSLALAGGTAVMA
TPGEFTGFSRLRVLARDGRCRAFAASADGMGLAEGVGVLLLERLSDAQRNGHPVLAVVRG
SAANSDGASSGLTAPNGPSQERVIRAALANAGLSTVDVDAVEAHGTGTTLGDPIEAQALL
ATYGRGRSGDPLWLGSVKSNLGHTQAAAGVAGVMKMVLAMRHGVLPKTLHVDEPTPHVDW
SSGAVSLLTEPVPWPETGRPRRAGVSGFGLGGTNAHVVLEQAPVEETPAAGPVPVVVPWV
LSGKGPAALRAQADRLASEVDTEASVADVGLSLATTRSLHQDRAVVVGANREELLRGLRA
IADGTPGPGVTTGRALVRDGVVFAFPGQGAQWAGMAVELLGVSSVFAGSMGACGEALSPF
VEWSLFDVLGDGGLLGRVDVVQPVLWAVMVSLAEVWRSFGVEPAAVVGHSQGEIAAACVA
GGLSLEDGAKVVALRSKALLKLSGGGGMVSVALPEAEVRERIDDRISVAAVNGPASVVVS
GELDALDALVESCAAEDIRAKRIPVDYASHSPQVESIREHLLEVLADITPRPGKIPFCSA
VTGTVIDTGELDAGYWYRNLRQTVLFEPATRGLLAQGNRAFVEVSPHPVLVTALQETDGD
AAVVGTLRRDDGGLSRMLTSLAEANVQGIEVDWTPAFPGARRVELPTYAFQRQRYWLDRP
SAHGGEEVHPVLDTIVGLAEGDGLVLTGRLSLATHAWLADHTVLGTVVVPGTALVELALR
AGAEAGCGRVEELTLETPLVLPENGAVQVQLTVGGADNAGNRPVSLHSRTDDAPWTRHAT
GLLAEAPPLPEPLADQWPPAGAQPVDVSDFYDRLTEQGYQYGPVFQGLRAVWTRGAETFA
EVDLPGDTQEEAGRFGLHPALFDAALHPVAIDPDGTADGRARLPFSWTGVSLHQPGAAAV
RVRLKQSGPGAVTAELADATGRPVLSVEALVARPVSAAQLGAVRGEDHGALFRVDWIEAA
AAEAPGSIAVVGEALFDGDHPRCPDLAALAAEPSIPDIVYAACPADQAGETAEAVRAALG
KTHELLCAWLAEERFAASRLVLVTRNAVGDQPDLRAAPIWGLVRSAQSEHPDRFVLVDLD
DHDTSARALPTAAALGEPQVALREGQPLVPRLARVSPGTEAPPEFGADGTVLVTGAGGVL
GGVFARHLVTEYGVRRLLLVSRRGELPELRTGLEALGAHVTMAACDVTDRDALARVLADH
PVTGVVHTAGVVDDGVLEALTPERFDRVLGPKVDGALALHELTRDLGLSAFVVFSSAATT
MGAPGQANYAAANAFLDALVHHRRARGLPGTSLAWGMWAERSAMTAQLTDGDLHRMERTG
ISPLTTEQGVALFDAALRGPEPVVVPIRLNPAAVRLRPGAVPAMLRGLVKAPRRREQAPV
DLPARLTGLSEEDQRRLLLDVVRAQAVDVLGYVSAGEVEPGKAFSDLGFDSLTAVELRNR
LATATGLRLPATLVFDHPTPEALAGELRARLSPEPVTDVAAILAELDGLAEKLAALDTDA
QTIVDTRLARLISRRDGEASAADRLAAATDDEVFAFIDNDLGR
NT seq 5352 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaagatgaccgaagcgaaacttctcgaccacctcaagtggatgaccggcgag
ctgcggcagacccgcaggcagctcggtgaagccgaggcgcgggaccgcgagccgatcgcg
atcgtggcgatgagctgccggttccccggcggcgtgaccagcccggacgagctgtgggag
ctggtttcggccggccgtgacgcggtcaccgggttcccgcgtgaccgcggctgggacgtg
gacgggctctacgatcccgacccggaccggccgggcacctcctacgtccgcgaaggcgga
ttcatcgaaggcgccgcggacttcgatccggcgttcttcggcatctcgccgcgcgaggcg
ctcgcgaccgatccgcagcagcggctggtgctggagacctcctgggaggcgttcgagcgc
gccgggatcgatccggcgacgctgaacggcagcagcaccggggtttttgtcggctgcagc
ggccaggagtacacctcgatggccgcgcagacctcgaacgatctcgcgtcctatgtggtc
agtgggaccgcgcccagcgtggtttccggccgggtggcgtacgtgctcggcctgaccggg
cccgcgctgaccatcgacaccgcgtgctcgtcgtcgctggtggcgctgcacctggcggcc
cggtcgctgcggtcgggtgaatgctcgctggcgctcgccggtggcacggcggtgatggcg
actcccggcgagttcaccgggttcagcaggctccgcgtgctcgcgcgcgatgggcgttgc
cgtgcgttcgccgcgtcggccgacggcatgggcctggccgagggcgtgggggtgctgctg
ctggaacggctgtccgacgcccagcggaacgggcacccggtgctggccgtggtgcgtggt
tccgcggcgaattccgacggtgcgtcgagcgggctgacggcgccgaacggcccgtcgcag
gagcgcgtgatccgggcggcactggcgaacgccggtctgtccactgtggatgtggacgcg
gtggaggcacacggcacgggcaccactctgggcgacccgatcgaggcgcaggcgttgctc
gcgacgtacgggcggggcaggtcgggtgatccgctgtggctggggtcggtgaagtcgaac
ctggggcacacacaggccgcggccggggtggccggagtgatgaagatggtgctcgcgatg
cggcacggcgtgctgccgaagaccttgcacgtggacgagccgacgccgcacgtggactgg
tccagtggtgcggtgtcgctgctgaccgagccggtgccgtggccggaaaccggcaggccg
cgccgggcgggcgtgtccggcttcgggctcggcggcaccaacgcgcacgtggtgctggaa
caggcgccggtcgaggaaacgcctgctgccggaccggtaccagtggtggtcccgtgggtg
ctgtccggcaagggaccggccgccctccgcgcacaggccgaccggctggcgtccgaagtg
gacaccgaggcgagtgtggcggatgtcgggctgtcgctggccaccacccgctcgctgcac
caggaccgcgcggtggtcgtcggcgcgaaccgtgaggaactgctgcgcgggctgcgcgcg
attgccgacggcacaccgggacccggggtgaccaccggcagggcgctcgtcagggacggc
gtggtcttcgcctttcccggtcagggtgcgcagtgggcgggtatggcggtggagttgctg
ggcgtttcgtcggtgtttgcggggtcgatgggggcgtgtggggaggcgttgtcgccgttt
gttgagtggtcgttgtttgatgtgctgggggatgggggtttgttggggcgggttgatgtg
gtgcagccggtgttgtgggcggtgatggtgtcgctggctgaggtgtggaggtcgtttggg
gtggagccggcggcggtggtgggtcattcgcagggtgagatcgcggcggcgtgtgtggcg
ggtgggttgtcgcttgaggatggtgcgaaggtggtggcgctgcggagcaaggcgttgttg
aagttgtccggtggtggcggcatggtgtcggtggccctgccggaggcggaggtgcgggag
cggatcgacgatcggatttcggtcgcggcggtcaacggacccgcctcggtggtcgtttcc
ggcgagctggacgcgctggatgcactggtcgaatcctgtgccgccgaagacattcgcgcg
aagcggatccccgtggactacgcctcgcactcaccacaggtcgagtcgatccgcgagcac
ctgctcgaagtcctggcggacatcacgccccggccgggcaagatcccgttctgctcggcg
gtcaccggcaccgtgatcgacaccggtgaactcgacgccgggtactggtaccgcaacctc
cggcagaccgtgttgttcgagccggccacccgtggcctgctcgcccagggcaaccgcgcg
tttgtcgaggtcagcccgcatccggtgctggtcaccgcgttgcaggagacggacggcgac
gccgcggtcgtgggcacgctccggcgtgacgacggcggcctgtcccggatgctgacctcg
ctggccgaggcaaacgtgcagggcatcgaggtggactggacgcccgcgttccccggcgcg
cgacgggtcgagctgcccacctacgccttccagcggcagcgctactggctggaccggccg
tccgcgcacggcggcgaagaagtgcaccccgtgctcgacacgatcgtcggcctcgccgaa
ggtgacggcctggtgctgaccggccgcctgtcgctggccacccatgcctggctggccgac
cacaccgtgctcggcaccgtggttgtgcccggtaccgcgctcgtcgagctggcgttgcgc
gcgggcgccgaggccggatgcggtcgcgtcgaggaactcaccctggaaacgccactggtg
ctgcccgagaacggcgcggtgcaggtgcagctcaccgtcggcggcgccgacaacgcgggc
aaccggccggtcagcctgcactcccgcaccgatgacgcgccctggacccgtcacgcgacc
ggcctgctcgcggaagcgccgccgctgcccgagccgttggccgaccagtggccgcccgcc
ggtgcgcagccggtcgacgtgagcgacttctacgaccgcctgaccgagcagggttaccag
tacgggccggtgttccagggcctgcgggcggtgtggacccgtggtgcggaaaccttcgcc
gaagtggaccttcccggcgacacgcaggaggaggccgggcggttcggcttgcatccggcc
ctgttcgacgcggcactgcacccggtcgcgatcgacccggacggcaccgctgacggcagg
gctcgcctgccgttctcgtggaccggggtttcgttgcaccagccgggtgccgccgccgtt
cgtgtccggttgaagcagtcgggtcccggcgcggtgaccgccgagctggcggatgcgacc
ggccggccggtgctctcggtggaggcgctggtggcccggccggtgtcggcggcccagctc
ggcgccgtgcgcggtgaggaccacggcgccctgttccgggtcgactggatcgaagcggcc
gcggcggaagctcccggctcgatcgcggtcgtgggtgaggcgctgttcgatggtgatcac
ccccgctgtccggacctggccgcgctggcggccgaaccgtccattccggacatcgtctac
gccgcctgcccggcggaccaggcgggggagaccgcggaggcggtacgcgcggcactcggg
aagacccacgaactgctgtgcgcgtggctggccgaggaacggttcgcggcgagcaggctg
gtgctggtcacccggaacgcggtcggtgaccagccggacctgcgagccgccccgatctgg
ggcctggtccggtccgcgcaatcggaacaccccgaccggttcgtcctggtcgatctcgac
gaccacgacacttcggcgcgtgcgctgccgaccgcggcggcgctcggcgaacctcaggtc
gcactgcgggaagggcagccgctggtgcccaggctggccagggtgtcgccgggcaccgag
gcaccaccggagttcggcgcggacggcacggtgctggtgaccggcgccgggggcgtgctg
ggcggggtgttcgcccgtcacctggtcaccgagtacggggtgcggcggctcctgctggtc
agccgccgcggtgagctgccggaactgcggaccggcctggaggcgctcggcgcgcacgtc
accatggccgcctgtgatgtcaccgaccgggacgcgctggccagggtgctcgcggaccat
ccggtgaccggtgtggtgcacaccgcgggcgtggtcgacgacggggtgctcgaagcactg
acccccgagcggttcgaccgggtgctcggccccaaggtggacggcgcgctcgccctgcac
gagctgacccgggacctcggcctgtcggcgttcgtggtgttctcctcggcggccaccacc
atgggtgcgccggggcaggccaactacgcggccgccaacgccttcctggacgcgctggtc
caccaccgccgcgcccgcgggctgcccggcacctcgctcgcgtggggcatgtgggccgag
cgcagcgcgatgaccgcccagctcaccgacggcgacctgcaccgcatggagcgcaccggg
atcagcccgctgaccaccgagcagggcgtcgcgttgttcgacgccgccctgcgcgggccg
gaaccggtggtggtgccgatccggttgaacccggcggcggtccggctgcggccgggcgcg
gtgcccgcgatgctgcgcggcctggtgaaagccccgcgtcgccgcgaacaggcaccggtg
gatctccccgccaggctcaccggactgtccgaagaggaccagcggcgcctgctgctggac
gtggttcgggcgcaggcggtcgatgtgctcggttacgtgtccgccggcgaggtcgagccg
ggcaaggcgttctccgatctcggcttcgactcgctgaccgccgtcgagctgcgcaaccgg
ctcgctaccgcaactggcctgcggctgcccgcgacgctggttttcgaccacccgaccccg
gaagcactggccggagaactgcgggcacgcctgtcaccggagccggtgaccgatgtcgcg
gcgatcctcgccgaactcgacggcctggcggagaagctggccgcgctggacaccgacgcg
cagaccattgtggacacccggctggcgaggctgatctcccggcgcgacggggaagcctcg
gccgccgatcggctggcggccgccaccgacgacgaggtcttcgccttcatcgacaacgac
ctggggcgctga

DBGET integrated database retrieval system