KEGG   Amycolatopsis albispora: A4R43_13730Help
Entry
A4R43_13730       CDS       T05547                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
aab  Amycolatopsis albispora
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RecC_C
Motif
Other DBs
NCBI-ProteinID: AXB43475
UniProt: A0A344L601
LinkDB All DBs
Position
2976505..2977578
Genome map
AA seq 357 aa AA seqDB search
MTRMSLTMPVKPMLAKPAKSIPDSGGLLFEPKWDGFRCLVFRDGAELTLQSRTGKPLNRY
FPEVLEALAGILPEQVVLDGELVIGRGGRLDFDALTERIHPAASRVELLSQETPAQFVAF
DLLELNGESLLDEPTERRRARLEQLPGVFITPATTDPAVARHWFELFEGAGLDGVIGKPL
DAAYEPGKRLMLKYKHSRTADCVLAGLRWHVDGEPGEMVGSFLLGLYDEHGVLHHVGVVG
SFPVTRRRELAEELAPLITDGPHPWLGDAVVPGQRLPGSVNRWRAGEQPWVPLRLERVVE
VGYEHTEGGHPARFRHTAQFARWRPDREPSSCDYAQLEEPARYDLDAVFRGEVRRVG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcatgtcgctgacgatgccggtcaagcccatgctcgccaagccggccaagtcc
atcccggactcgggcgggctgctgttcgagccgaagtgggacggtttccgctgcctggtc
ttccgcgacggcgccgagctgaccctgcagtcgcgcaccgggaaaccgctgaaccggtac
ttccccgaggtgctcgaagcgctcgcgggcatcctgccggagcaggtggtgctcgacggt
gagctggtcatcggccgcggcggcaggctcgacttcgacgcgctgaccgagcgcatccac
cccgccgcgagccgcgtcgagctgctctcgcaggagacgccggcccagttcgtcgccttc
gacctgctggagctgaacggcgagtcgctgctggacgagccgaccgagcgccgtcgcgcc
cggctggagcagctgcccggtgtgttcatcaccccggccaccaccgatccggcggtggcg
cggcactggttcgagctgttcgagggtgccgggctggacggtgtgatcggcaagccgctg
gacgccgcctacgagccgggcaagcggctcatgctcaagtacaagcactcgcgcaccgcg
gactgcgtgctggccgggctgcgctggcacgtcgacggcgagccgggcgaaatggtcggc
tcgttcctgctgggtctctacgacgagcacggcgtgctgcaccacgtcggcgtggtgggt
tccttcccggtgacacggcggcgtgaactggccgaggaactggcgccgctgatcaccgac
ggcccgcacccgtggctcggcgacgccgtggtgccggggcagcggctgcccggttcggtc
aaccgctggcgtgcgggggagcaaccgtgggtgccgctgcggctggagcgcgtggtcgag
gtcggctacgagcacaccgagggcgggcacccggcgcggttccggcacaccgcgcagttc
gcccgctggcggccggaccgcgaaccgtcctcgtgcgactacgcgcagctcgaagagccg
gccaggtacgacctggacgcggtgttccgcggtgaggtcaggcgggtcggctga

DBGET integrated database retrieval system