KEGG   Amycolatopsis albispora: A4R43_19535Help
Entry
A4R43_19535       CDS       T05547                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aab  Amycolatopsis albispora
Pathway
aab00473  D-Alanine metabolism
aab00550  Peptidoglycan biosynthesis
aab01100  Metabolic pathways
aab01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A4R43_19535
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A4R43_19535
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    A4R43_19535
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aab01011]
    A4R43_19535
Enzymes [BR:aab01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A4R43_19535
Peptidoglycan biosynthesis and degradation proteins [BR:aab01011]
 Precursor biosynthesis
  Amino acid ligase
   A4R43_19535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AXB44439
UniProt: A0A344L8R5
LinkDB All DBs
Position
complement(4229295..4230386)
Genome map
AA seq 363 aa AA seqDB search
MTAAKTRVAVVFGGRSTEHTISCVSAGSVLANLDPERFEIVPIGITREGGWVLGTSDPDR
LRIEGDQLPVVADGRSLVLTGDRTNRELVSLDAGVDAIGAVDVIFPVLHGAFGEDGTIQG
LLELADVPYVGAGVLASATAMDKEFAKKLLAAEGLPGGDYAVLRRGQSTLPEAERERLGL
PVFVKPARAGSSIGISKVTDWSQLDAAIALARETDPKVLVEAAVVGREVECGVLEFPDGR
VEASLPAEIRVLATDESAWYDFETKYLGEAAELDIPAKLDDQVTERLREMAVDAFHALDC
QGLARVDFFVGADGTLTINEVNTMPGFTATSAYPKMWAVTGVDYPTLLSTLVDTALARGT
GLR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagccaagacgcgggtcgccgtggtgttcggcggccgcagcaccgagcacacc
atctcctgcgtttcggcgggcagtgtgctggcgaacctggatcccgagcggttcgagatc
gtgcccatcggcatcacccgcgagggtggctgggtgctcggcacgagcgacccggaccgc
ctgcgcatcgagggcgaccagctgccggtggtggccgacggccgcagcctggtgctcacc
ggtgaccgcaccaaccgcgaactggtctcgctggacgccggggtggacgcgatcggcgcg
gtggacgtgatcttcccggtgctgcacggcgccttcggtgaggacggcaccatccagggc
ctgctggaactggcggacgtgccctacgtcggtgccggcgtgctcgccagcgcgacggcg
atggacaaggagttcgccaagaagctgctcgccgccgagggcctgcccggcggcgactac
gcggtgctccggcgtggacagtccactttgcccgaagccgagcgcgaacgccttggcctg
ccggtttttgtcaaaccggccagggccgggtcctcgatcggcatcagcaaggtgaccgac
tggtcccagctggacgcggcgatcgcgctggcccgcgagaccgatccgaaggtgctcgtc
gaggccgcggtggtcggccgtgaggtcgaatgcggcgtgctggagttccccgacggccgg
gtcgaagcctcgctgcctgcggagatccgcgtgctcgccaccgacgaaagcgcctggtac
gacttcgaaaccaagtacctcggcgaggcggcggagctggacatcccggcgaagctggac
gaccaggtgaccgagcgcctgcgcgagatggccgtcgacgccttccacgcgctggactgc
cagggcctggccagggtggacttcttcgtcggcgccgacggcacgctcaccatcaacgag
gtgaacaccatgccgggcttcaccgccacctcggcctacccgaagatgtgggcggtgacc
ggggtggactacccgaccctgctgtccactttggtcgacaccgcgctggcccgcggcacc
ggcctgcgctga

DBGET integrated database retrieval system