KEGG   Amycolatopsis albispora: A4R43_22850Help
Entry
A4R43_22850       CDS       T05547                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
aab  Amycolatopsis albispora
Pathway
aab00071  Fatty acid degradation
aab00280  Valine, leucine and isoleucine degradation
aab00281  Geraniol degradation
aab00310  Lysine degradation
aab00362  Benzoate degradation
aab00380  Tryptophan metabolism
aab00410  beta-Alanine metabolism
aab00640  Propanoate metabolism
aab00650  Butanoate metabolism
aab00903  Limonene and pinene degradation
aab00930  Caprolactam degradation
aab01100  Metabolic pathways
aab01110  Biosynthesis of secondary metabolites
aab01120  Microbial metabolism in diverse environments
aab01130  Biosynthesis of antibiotics
aab01200  Carbon metabolism
aab01212  Fatty acid metabolism
Module
aab_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A4R43_22850
   00650 Butanoate metabolism
    A4R43_22850
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A4R43_22850
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A4R43_22850
   00310 Lysine degradation
    A4R43_22850
   00380 Tryptophan metabolism
    A4R43_22850
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A4R43_22850
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A4R43_22850
   00281 Geraniol degradation
    A4R43_22850
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A4R43_22850
   00930 Caprolactam degradation
    A4R43_22850
Enzymes [BR:aab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     A4R43_22850
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A4R43_22850
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     A4R43_22850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 UDPG_MGDP_dh_N 2-Hacid_dh_C F420_oxidored NAD_binding_8 AlaDh_PNT_C NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AXB44986
UniProt: A0A344LAB2
LinkDB All DBs
Position
complement(4906204..4908372)
Genome map
AA seq 722 aa AA seqDB search
MTEAKTIRWEQDADGIVVLTLDDPKQSANTMNADFRESLGVVVDRLEAEKDNITGVVLTS
AKKTFFAGGDLNDLIQAKPENAAEITESSGRMKAQMRRLEQLGRPVVAAINGAALGGGLE
LALATHHRIAADVKGSQIGLPEVTLGLLPGGGGVVRTVRLLGIQSALLNVLLQGQRHKPA
KALELGLVHELVGSVDELLPKAKEWIKANPEAVQPWDVKGYKIPGGTPSNPKFAANLPAF
PANLRKQIKGANMPAPRAILSAAIEGSQVDFDTAQLIETRYFVHLATGQVAKNMTKAFFF
DLQHINSGGSRPDGFEKYTAKKVGVLGAGMMGAAIAYVSAKAGIDVVLKDVSQEAAEKGK
GYAVKLEEKALSRGKTTQEKSDALLARIKPTADPADFAGVDFVIEAVFESVELKHKVFGE
IEGIVNADAVLGSNTSTLPITSLAEGVQRQEDFIGIHFFSPVDKMPLVEIICGEKTSPAT
LAKVFDYTLQIRKTPIVVNDSRGFFTSRVIGTFINEAVAALGEGVEPASIEQAGAQAGYP
APPLQLMDELTLTLPRKIRLESKAAVEAEGGTWKGHASEAVIDRMVEEFDRKGRSSGAGF
YEYDDEGKRTGLWPGLRDAFKSGTADVPFEDLKERMLFAEALETVKCFDEGVLRSVQDAN
IGSIFGIGFPAWTGGVIQYINQYEGGLAGFVARSRELAERYGDHFLPPESLVAKAEKGEI
FE
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcgaagaccatccgctgggaacaggacgccgacggcatcgtcgtgctcacc
ctggacgacccgaagcagtcggccaacacgatgaacgcggacttccgcgagtcgctcggt
gttgtcgtcgaccgcctcgaagcggagaaggacaacatcaccggcgtggtgctcacctcg
gcgaagaagaccttcttcgccggtggtgacctcaacgacctgatccaggcgaagccggag
aacgccgccgagatcaccgagagcagcgggcggatgaaggcccaaatgcggcggctcgag
caactcggccgcccggtggtggcggcgatcaacggcgcggccctcggcggtggcctggag
ctggcgctggccacccaccaccgcatcgcggccgacgtcaagggcagccagatcggcctg
cccgaggtcaccctcggcctgctgcccggtggcggcggcgtggtgcggaccgtgcgcctg
ctgggcatccagagcgcgctgctgaacgtgctgttgcaggggcagcggcacaagccggcc
aaggcgctggagctgggcctggtgcacgagctggtcggcagcgtggacgagctgctgccg
aaggccaaggagtggatcaaggcgaaccccgaggccgtgcagccgtgggacgtcaagggc
tacaagatccccggtggcacgccgtcgaacccgaagttcgcggcgaacctgcccgcgttc
ccggcgaacctgcgcaagcagatcaagggcgcgaacatgccggcgccgcgggcgatcctg
tccgccgcgatcgagggctcgcaggtcgacttcgacaccgcgcagctgatcgagacccgg
tacttcgtgcacctggccaccggccaggtggcgaagaacatgaccaaggcgttcttcttc
gacctccagcacatcaactccggcggttcgcggccggacgggttcgagaagtacaccgcg
aagaaggtcggtgtgctcggcgccgggatgatgggcgcggcgatcgcctacgtctcggcg
aaggccgggatcgacgtggtgctcaaggacgtttcgcaggaagcggccgagaagggcaag
ggctacgcggtcaagctcgaggagaaggcgctctcgcggggcaagaccacgcaggagaag
tcggacgcgctgctggcgcgcatcaagccgaccgcggaccccgccgacttcgccggcgtc
gacttcgtgatcgaggccgtgttcgagagcgtcgagctgaagcacaaggtgttcggcgag
atcgagggcatcgtcaacgcggacgcggtgctgggttcgaacacctccacgctgccgatc
acctcgctcgccgagggcgtgcagcggcaggaggacttcatcggcatccacttcttctcg
ccggtggacaagatgccgctggtcgagatcatctgcggggagaagacctcgccggccacg
ctggccaaggtcttcgactacacgctgcagatccgcaagaccccgatcgtggtgaacgac
agccgcggcttcttcaccagccgggtgatcggcacgttcatcaacgaggccgtcgccgcg
ctgggtgagggtgtcgaaccggcgtcgatcgagcaggcgggggcgcaggccgggtacccg
gcgccgccgctgcagctgatggacgagctgacgctgaccctgccgcgcaagatccggctg
gagtccaaggcggccgtcgaggccgagggcggcacctggaaggggcacgcctcggaggcg
gtcatcgaccggatggtcgaggagttcgaccgcaagggccggtcgtccggtgcgggcttc
tacgagtacgacgacgagggcaagcggaccgggctgtggccggggctgcgtgacgccttc
aagtcgggcacggcggacgtcccgttcgaggacctcaaggagcgcatgctcttcgccgag
gcgctggagacggtcaagtgcttcgacgagggcgtgctgcggtcggtgcaggacgcgaac
atcgggtcgatcttcggcatcggcttcccggcgtggaccggcggtgtcatccagtacatc
aaccagtacgagggtggcctggccgggttcgtggcgcggtcgcgtgagctggccgagcgc
tacggcgaccacttcctgccgccggagtcgctggtggcgaaggccgaaaagggcgagatc
ttcgagtga

DBGET integrated database retrieval system