KEGG   Amycolatopsis albispora: A4R43_34595Help
Entry
A4R43_34595       CDS       T05547                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
aab  Amycolatopsis albispora
Pathway
aab00020  Citrate cycle (TCA cycle)
aab00480  Glutathione metabolism
aab01100  Metabolic pathways
aab01110  Biosynthesis of secondary metabolites
aab01120  Microbial metabolism in diverse environments
aab01130  Biosynthesis of antibiotics
aab01200  Carbon metabolism
aab01210  2-Oxocarboxylic acid metabolism
aab01230  Biosynthesis of amino acids
Module
aab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aab_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A4R43_34595
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A4R43_34595
Enzymes [BR:aab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A4R43_34595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AXB46945
UniProt: A0A344LFX1
LinkDB All DBs
Position
7381420..7382643
Genome map
AA seq 407 aa AA seqDB search
MAKIKVEGTVVELDGDEMTRIIWQFIKDKLVHPYLDLNLEYYDLGIEERDRTDDQITVDS
ANAIKRHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIIIQNIPRL
VPGWTKPIIIGRHAHGDQYKATDFKVPGPGTLTITYTPEDGSEPMEFEVAKYPEGGGVAI
GMYNYRRSIEDFARASLQYGLDREMPVYMSTKNTILKAYDGMFKDVFQEIFDAEFKADFD
AKGLTYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLRTPDG
KTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIYAWTRGLEHRGKLDSNAELIGFANKLE
QVVVETVESGKMTKDLALLVGKDQPYQTTEEFLATLDENLQKKVAQG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcaaggtcgaggggaccgtcgtcgagctcgacggcgatgagatgacccgc
atcatctggcagttcatcaaggacaagctggtccacccctacctggacctcaatctcgag
tactacgacctgggcatcgaggagcgggaccgcaccgacgaccagatcaccgtcgactcg
gcgaacgccatcaagcgccacggcgtcggcgtgaagtgcgccaccatcaccccggacgag
gcgcgcgtcgaggagttcggcctgaagaagatgtggcggagcccgaacggcaccatccgc
aacatcctcggcggtgtcgtcttccgcgagccgatcatcatccagaacatcccgcgcctg
gtacccggctggaccaagccgatcatcatcggccgccacgcccacggtgaccagtacaag
gccaccgacttcaaggtccccggccccggcacgctgaccatcacctacacgccggaggac
ggctccgagccgatggagttcgaggtcgccaagtacccggagggtggcggcgtcgcgatc
ggcatgtacaactaccgccgctcgatcgaggacttcgcccgcgcctcgctgcagtacggc
ctcgaccgcgagatgccggtctacatgtcgaccaagaacaccatcctcaaggcctacgac
ggcatgttcaaggacgtgttccaggagatcttcgacgccgagttcaaggccgacttcgac
gccaagggcctgacctacgagcaccgcctgatcgacgacatggtcgccgcggcgctgaag
tgggagggcggctacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacacc
gtggcgcagggcttcggctcgctcggcctgatgacctcggtgctgcgcaccccggacggc
aagaccgtcgaggccgaggccgcgcacggcacggtcacccggcactaccgccagcaccag
cagggcaagccgacctcgaccaacccgatcgcctcgatctacgcctggacccgcggcctc
gagcaccgcggcaagctggactcgaacgccgagctgatcggcttcgcgaacaagctggag
caggtcgtcgtggagaccgtcgagagcggcaagatgaccaaggacctcgcgctgctggtc
ggcaaggaccagccgtaccagaccaccgaggagttcctcgcgacgctggacgagaacctg
cagaagaaggtcgcccagggctga

DBGET integrated database retrieval system