KEGG   Amycolatopsis albispora: A4R43_36520Help
Entry
A4R43_36520       CDS       T05547                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
aab  Amycolatopsis albispora
Pathway
aab03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aab00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    A4R43_36520
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aab03400]
    A4R43_36520
Enzymes [BR:aab01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A4R43_36520
DNA repair and recombination proteins [BR:aab03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A4R43_36520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AXB47278
UniProt: A0A344LGV4
LinkDB All DBs
Position
7788602..7789594
Genome map
AA seq 330 aa AA seqDB search
MAGAPEDARVPAAVEPMLAQAGPLPDDARYNYEFKWDGYRACLRVSPSGEIRLNSRNGND
LTAEYPELADGVGDMLGGRAAVFDGEVVALDEGGVPDFTLLQNRRTRRHALSFFAFDLLQ
LGTDVLLNRTYRERRDLLVQLEPGNPNLIAIPPAYSHADLSATGLTPQGLLDVARQSRLE
GLVAKAGESRYHPGRRSPEWIKHALITTQEVVIGGWRPGGGRREGTLGALLLGAHDSRGD
LRYIGDVGTGFTQQALDDLHARLRTLDRSTSPFADQVPRDRAKGAHWVDPHLVGEVVYRR
LTSDGRLRHTAWRGLRPDRTPAEAVLDALG
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgcaccggaggacgcccgcgtaccggccgcggtggagccgatgctcgcgcag
gccggtccgctgccggacgacgccaggtacaactacgagttcaaatgggacgggtaccgc
gcgtgcctccgcgtgagcccgtccggcgaaatccgcctgaacagccgcaacggcaacgat
ctcaccgccgaatatcccgagctggccgacggcgtcggcgacatgctcggcggccgcgcc
gccgtgttcgacggggaggtcgtcgcgctcgacgagggcggcgtccccgacttcacgctg
ctgcagaaccgccgcacccggcggcacgcgctcagcttcttcgccttcgacctgctccag
ctgggcaccgacgtcctgctgaaccggacctaccgcgagcgccgcgacctgctggtccag
ctcgaacccggcaacccgaacctgatcgccatcccgcccgcgtacagccacgccgatctg
tccgccaccggcctgaccccgcagggattgctcgacgtcgcccggcagtcacgcctggaa
gggctggtcgccaaggcgggtgaatctcggtaccaccctggccgccggagtccggaatgg
atcaagcacgcgctgatcaccacgcaggaggtggtgatcggcggctggcggcccggcggc
ggccgccgcgagggcacgctcggcgcgctgctgctcggcgcccacgacagccgcggcgac
ctgcggtacatcggcgacgtcggcaccggtttcacccagcaggcactcgacgatctgcac
gccagactgcggacgctcgaccgctccaccagcccgttcgccgaccaggtcccgcgcgac
cgcgcgaagggcgcgcactgggtcgacccccacctggtcggcgaggtcgtctaccgccgc
ctcacctccgacggccgcctgcggcacacagcctggcgaggcctccgccccgaccgcacc
ccagccgaggcggtactggacgccttgggctga

DBGET integrated database retrieval system