KEGG   Amycolatopsis albispora: A4R43_38395Help
Entry
A4R43_38395       CDS       T05547                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
aab  Amycolatopsis albispora
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AXB49115
UniProt: A0A344LM41
LinkDB All DBs
Position
8253713..8254771
Genome map
AA seq 352 aa AA seqDB search
MPPVKPMLAKSVRDVPRGPGVLYEPKWDGFRCIVFRDGDEVELGSRNDRPLTRYFPELVE
LLRAALPPRCVVDGEIVVVTGAGLDFDTLQNRLHPAASRVQKLAVETPASFVAFDLLALG
DRDLTEEPFAERRRLLASLLSDALSQIVLTPVTDDPAVAEDWFTRFEGAGFDGVMAKPGD
QPYEQDKRVMWKVKHERTADCVVAGFRWHKDGEGVGSLLLGLYDDNGRLHHVGVASSFTA
ARRRELVDELAPLRENAMAEHPWRAWAEEHAQVGGRMPGGVSRWTGKKDLSWEPLRAEWV
AEVRYEHVLAGRFRHGGRLVRFRPDRDPKSCTYAQLEEVAPAELTALFGSAG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggtgaaaccgatgctggccaagtccgtccgtgacgtgccgcgcggacccggt
gtgctgtacgagccgaagtgggacggcttccgctgcatcgtcttccgcgacggcgacgag
gtcgagctggggtcccgcaacgaccgcccgctcacccgctacttccccgagctggtcgag
ctgctgcgggccgcgctgccgccgcggtgcgtggtggacggcgagatcgtggtggtcacc
ggcgccgggctggacttcgacacgctgcagaaccggctgcacccggccgcttcccgcgtg
cagaagctggccgtggagacgcccgccagcttcgtcgccttcgacctgctcgcgctcggc
gaccgcgacctgaccgaggagcccttcgccgaacgccgccgcctgctggcgagcctgctg
tccgacgcgttgtcgcagatcgtgctcaccccggtcaccgacgatcccgcggtcgccgaa
gactggttcacccggttcgagggcgccgggttcgacggcgtgatggccaagccgggcgac
cagccgtacgagcaggacaagcgcgtgatgtggaaggtcaagcacgagcgcacggccgac
tgcgtggtggccgggttccgctggcacaaggacggtgagggcgtcggctcgctgctgctc
ggcctctacgacgacaacgggaggctccaccacgtcggcgtggccagcagcttcaccgcc
gcgcggcgccgggaactggtcgacgagctggcgccgttgcgggagaacgcgatggccgag
cacccgtggcgcgcgtgggccgaggagcacgcgcaggtgggcggccggatgccgggcggg
gtgagccggtggaccggcaagaaggacctgtcgtgggaaccgctgcgtgccgaatgggtg
gccgaggtccggtacgagcacgtgctggccgggcggttccggcacggcggcaggctggtc
cgcttccggcccgaccgcgatccgaagtcctgcacctacgcccagctcgaagaggtcgcg
cccgcggagctgaccgcgttgttcgggagcgccggatga

DBGET integrated database retrieval system