KEGG   Amycolatopsis albispora: A4R43_39625Help
Entry
A4R43_39625       CDS       T05547                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
aab  Amycolatopsis albispora
Pathway
aab00250  Alanine, aspartate and glutamate metabolism
aab00410  beta-Alanine metabolism
aab00640  Propanoate metabolism
aab00650  Butanoate metabolism
aab01100  Metabolic pathways
aab01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A4R43_39625
   00650 Butanoate metabolism
    A4R43_39625
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A4R43_39625
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A4R43_39625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aab01007]
    A4R43_39625
Enzymes [BR:aab01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A4R43_39625
Amino acid related enzymes [BR:aab01007]
 Aminotransferase (transaminase)
  Class III
   A4R43_39625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AXB47809
UniProt: A0A344LID5
LinkDB All DBs
Position
8665739..8667037
Genome map
AA seq 432 aa AA seqDB search
MTESELLSRHRAVLPNWLALYYDEPIEIVRASGRRVTDANGNTYLDFFAGILTNAIGYDV
AEISDAIRRQLDSGVLHTSTLYLIRKQVELAEQIAELSGIEGAKVFFTNSGTEANETALM
LATQYRRSNQILALRNSYHGRAFATVGITGNRGWSASSLSPVKVSYVHGGYRYRSPFSSL
SDADFIAACTDDLRDVLQTSTSGDVAAMIAEPIQGVGGFNVPPDGFFGSFKEVLDEHGIL
LISDEVQTGWGRTGEHFWGMRAHGVTPDMMTFAKGLGNGLAIGGVVARGEVMDCLTANSI
STFGGNPVSTAGAKATLDYLLDNDLQGNAAKQGDTLFGGLRDLAERYDVLGDVRGKGLMI
GLELVEADRSPSPPSAGVVLEEAKKRGLLVGKGGLHGNVIRLAPPMTLTDAETGEALEIL
EGSIAAAQEARK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatcggagctgctctccaggcatcgcgcggtgctgccgaactggctggccctc
tactacgacgagccgatcgagatcgtccgtgcctccgggcgccgggtcaccgacgcgaac
gggaacacctatctcgacttcttcgcgggcatcctgaccaacgcgatcggctacgacgtc
gcggagatctccgacgcgatccgccgccagctcgacagcggggtgctgcacacctccacc
ctgtacctgatccgcaagcaggtcgagctggccgagcagatcgccgagctgtccggcatc
gagggcgcgaaggtgttcttcaccaactcgggcaccgaagccaacgagaccgcgctgatg
ctggcgacgcagtaccggcgcagcaaccagatcctggcgctgcgcaactcctaccacggg
cgcgcgttcgccacggtcgggatcaccggcaaccgcggctggtcggccagctcgctgtcc
ccggtcaaggtcagctacgtgcacggcggttaccgctaccgcagcccgttctcctcgctg
tccgacgcggacttcatcgccgcctgcaccgacgacctgcgtgacgtgctgcagaccagc
acctccggtgacgtggccgcgatgatcgccgagccgatccagggcgtcggcggcttcaac
gtgccgccggacgggttcttcggctcgttcaaggaggtgctcgacgagcacggcatcctg
ctcatctccgacgaggtgcagaccggctgggggcgcaccggcgagcacttctggggcatg
cgggcacacggcgtgaccccggacatgatgaccttcgccaaggggctggggaacgggctg
gccatcggcggcgtggtcgcgcgcggtgaggtgatggactgcctgaccgcgaactccatt
tcgaccttcggcggcaacccggtctccaccgcgggcgcgaaggccactttggactacctg
ctggacaacgacctccagggcaacgccgccaaacagggcgacacgctgttcggcggcctg
cgtgacctcgcggagcgctacgacgtgctcggcgacgtccgcggcaaggggctgatgatc
gggctggagctggtcgaggcggaccgctcgccgagcccgccgtcggccggtgtggtactg
gaagaggcgaagaagcgcgggctgctggtcggcaagggcgggctgcacggcaacgtcatc
cggctggccccgccgatgaccctcaccgacgccgaaaccggtgaggcactggagattctc
gaaggttcgatcgcggcggcgcaggaggcacgcaagtga

DBGET integrated database retrieval system