KEGG   Amycolatopsis albispora: A4R43_40445Help
Entry
A4R43_40445       CDS       T05547                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
aab  Amycolatopsis albispora
Pathway
aab00500  Starch and sucrose metabolism
aab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A4R43_40445
Enzymes [BR:aab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     A4R43_40445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-ProteinID: AXB47943
UniProt: A0A344LIR9
LinkDB All DBs
Position
complement(8826981..8829395)
Genome map
AA seq 804 aa AA seqDB search
MKSPKRRVSAALLTLALVALPAPAAAAPAEAPGAPGTGSAWTTGGKEGFGTSAGTASKVW
FTLGQGINHEVYYPTVDVANVQDLQYVVSDGAGFTQLERDHTTKQVTLIDPRSLSYRQTN
TATNGRYRITKTHTTDPARATVLIQTRFEVLSGGPLQLYALYNPSLNNSGMGDTGATANG
QLVASDGPVSSALAASTGFSKLTSGYSGSASDGYVDLSGNHVLDAQYDSAPASGNLVQLG
QIPVGTDTTFTLALGFGGNRAAASATASASLTGGFTAADTAYRSGWHNYLSSLNAVPGSI
TGAGLTTQYNVALMTLKAHEDKTYLGANVASLTNPWGEAKDANGTGDCGYHAVWSRDLYQ
VSTAQIAAGDTAAANRSADYLFTVQQRPDGSFPQNTRLDGTNCWTSLQLDEVAFPIVLVW
QLQRFDAAMWAKVKKSADFLVSRGPSTPQERWEENGGYSPSTIAAEIAGLICAADIAERN
GDTASANTYRTTADQWQAQVTGWTFTTTGPLGDGRYFERIDGNGNPNDGQHIFLQNGGGN
HDERAIIDAGFLELVRLGVKPAADPDVAAALPEVDSTLKVNTPNGPMWYRYNHDGYGETA
SGGPYTGAGIGRLWPLLTGERGEYELANGRSASAHLATMAAAANPGYLIPEQVWDRASTG
GFTFGEGTGSATPLAWSMAQFVRLAHSIDAGAPVETPSVVKQRYANGCASVSAQFSVNAT
TTWGQNIFVVGDRPELGSWNPANAVPLSSVNYPQWTGTVGLPKDTTFQYKYLRKEGDAVT
WESGANRVATATGCTLALTDTWRP
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctccgaagcggcgcgtttccgccgctctgctcacgctcgccttggtcgccttg
cccgcgccggccgccgccgcgcccgctgaagcccccggcgcgccgggcaccggctcggcc
tggaccaccggcggcaaggaggggttcggcacctccgccgggaccgcctccaaggtctgg
ttcaccctcggccagggcatcaaccacgaggtctactaccccaccgtggacgtggccaac
gtgcaggacctgcagtacgtggtctccgacggcgccgggttcacccagctcgaacgcgac
cacaccaccaagcaggtgacgctgatcgatccgcggtcgctgagctaccggcagaccaac
accgccaccaacggccgctaccggatcaccaaaacgcacaccaccgacccggcacgcgcg
accgtgttgatccagaccaggttcgaggtgctcagcggcgggccactccagttgtacgcg
ctgtacaacccgtcgctgaacaacagcggcatgggcgacaccggcgcgaccgcgaacggc
cagctggtcgcctccgacggcccggtgtccagcgcgctggccgcgtccaccggattcagc
aagctgaccagcgggtacagcggcagtgcgagcgacgggtacgtggacctcagcggcaac
cacgtgctggacgcgcagtacgactccgcgccggcgtccgggaacctggtgcagctgggc
cagatcccggtgggcacggacaccacgttcaccctcgccctgggcttcggcggcaaccgc
gcggccgcgtcggcgaccgcatcggcctcgctcaccggcggtttcacggccgccgacacc
gcctaccgctccggctggcacaactacctgtcctcgctgaacgccgtgcccggctcgatc
accggcgccgggctgaccacgcagtacaacgtcgcgctgatgacgctcaaagcccacgag
gacaagacctatctcggcgcgaacgtcgcctcgctgaccaatccgtggggtgaggcgaag
gacgcgaacggcaccggcgactgcggttaccacgccgtctggtcccgcgacctctaccag
gtctcgaccgcgcagatcgccgcgggcgacaccgcggcggcgaaccgttcggccgactac
ctgttcaccgtgcagcagcgcccggacggctcgttcccgcagaacacgcgcctcgacggc
accaactgctggaccagcctgcagttggacgaggtcgcgttcccgatcgtgctggtgtgg
cagctgcagcggttcgacgcggcgatgtgggcgaaggtgaagaagtcggcggacttcctg
gtctcgcgtggtccgtcgacaccgcaggaacgctgggaggagaacggcgggtactcgccg
tccaccatcgccgcggagatcgccgggttgatctgcgccgccgacatcgccgagcgcaac
ggcgacacggccagcgcgaacacctaccgcaccaccgccgaccagtggcaggcgcaggtg
accggctggaccttcaccaccaccggcccgctcggcgacggccggtacttcgagcgcatc
gacggcaacgggaatcccaacgacggccagcacatcttcctccagaacggtggtggcaac
cacgacgagcgcgccatcatcgacgccgggttcctggagctggtacggctcggtgtgaag
cccgcggccgatccggacgtcgcggccgcactgcccgaagtggactcgacgctcaaggtg
aacaccccgaacggcccgatgtggtaccgctacaaccacgacggttacggcgaaaccgcc
tccggtggcccgtacaccggcgcggggatcggccggttgtggccgctgctcaccggcgag
cgcggggagtacgagctggcgaacggccggtcggcatcggcgcacctggccaccatggcg
gccgcggccaacccgggttacctgatcccggaacaggtctgggaccgggcgagcaccggg
ggcttcaccttcggcgagggcaccggctcggcgacgccgctggcgtggtcgatggcgcag
ttcgtccggctcgcccactcgatcgacgcgggtgcgccggtggaaacgccctcagtggtc
aagcagcggtacgcgaacggttgcgcgagcgtgtcggcccagttctcggtcaacgcgacc
accacgtggggccagaacatcttcgtggtcggcgaccggcccgaactcggctcgtggaac
ccggcgaacgccgtcccgctgtcctcagtgaactatccacagtggaccggcacggtcggc
ctgccgaaggacaccaccttccagtacaagtacctgcgcaaggaaggcgatgcggtcacc
tgggagtcgggagcgaaccgcgtggccacggccaccggctgcacgctggcgctgaccgac
acctggcggccctag

DBGET integrated database retrieval system