KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0689Help
Entry
Aaci_0689         CDS       T00985                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00970  Aminoacyl-tRNA biosynthesis
aac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aac00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Aaci_0689
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aac03029]
    Aaci_0689
Enzymes [BR:aac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Aaci_0689
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Aaci_0689
Mitochondrial biogenesis [BR:aac03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Aaci_0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey ApbA_C
Motif
Other DBs
NCBI-ProteinID: ACV57736
UniProt: C8WTJ4
LinkDB All DBs
Position
735994..737427
Genome map
AA seq 477 aa AA seqDB search
MNYETIIGLEVHVELKTDTKIFCGCRNDSKSEPNTNVCPVCLGHPGTLPVLNERALELAV
KAALALHCKINQKSKFDRKNYFYPDLPKGYQISQYDKPIGEHGYIEIEVNGETKRIGITR
LHLEEDAGKSMHAADGSHTLVDYNRTGVPLIEIVSEPDIRSPEEARLYLEALKSIMEYCD
VSDCKMEEGSLRCDANISLRPVGQTAFGNKVELKNMNSFRFVQRALEYEVERQRERYESG
EPVIQETRRFDEATQTTVSMRTKEEAHDYRYFPEPDLVDLDIDDAWLERIRASLPELPSA
KRRRYVEELGLPPYDAGVLTSDPKMAAYYEAVIAAGADAKQASNWVMSDVSGALNAEGKT
FADCPIPPEHLAGLIGEVASGKISSKQAREVFKLMWETGKSAAEIIKEKGFEQISDPAQL
QPIIDEVVANNPKSVADYKGGKERALAALVGQVMKATRGKANPTLVNEMLIEKIKSL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgagacgatcatcggcctcgaggtgcacgtcgagctgaagacggacaccaag
atcttctgcggctgccgcaacgacagcaagtcggagcccaacacgaacgtgtgcccggtc
tgcctcggccaccccggcaccctgccggtgttgaacgagcgggcgctggagcttgcggtc
aaggcggcgctcgcgctccactgcaagatcaaccagaagtcgaagttcgacagaaaaaac
tatttttaccctgaccttccgaaggggtatcagatctcgcagtacgacaagcccatcggc
gaacacgggtacatcgagatcgaggtgaacggcgagacgaagcgcattggcatcacgcgc
ctgcacttggaggaggacgcgggcaagtcgatgcacgccgcggacggatcgcacacgctc
gtcgactacaaccgcaccggcgtgccgctcatcgaaattgtgtcggagccggacatccgc
tcgccggaagaggcgcggttatacctcgaggcgctgaagagcatcatggagtactgcgac
gtgtccgactgcaagatggaggaggggtcgctgcgctgcgacgccaacatctccctccgc
ccggtgggacagacggcgtttggcaacaaggtcgagttgaagaacatgaactcgttccgg
ttcgtgcagcgcgcgctggagtacgaggtcgagcggcagcgcgagcggtacgagagcggt
gagcccgtgatccaggagacccgccgcttcgacgaggcgacccagacgacggtgtcgatg
cgcacgaaggaagaggcgcacgattaccgctacttccccgagccggacctggttgatctc
gacatcgacgacgcgtggctcgagcggatccgggcctcgctgcctgagttgccgtcggcc
aagcgccgccggtatgtagaggaactgggcctgcccccgtacgacgcgggcgtgctcacc
tccgatccgaagatggccgcgtactacgaggccgtgatcgcggccggcgccgacgcgaaa
caggcttcgaactgggtgatgagcgacgtctccggcgcgttgaacgccgagggcaagacg
tttgcggattgccccattccgcctgagcatctggcggggctcatcggcgaggtcgcgagc
ggcaagatctcgtcgaagcaggcgcgcgaggtgttcaagctgatgtgggagactggcaag
agcgcggccgagatcatcaaggagaagggcttcgagcagatcagcgatccggcccagttg
cagcccatcatcgacgaggtcgtggcgaacaatccgaagtcggtggcggactacaagggc
ggcaaggagcgcgcgctggcggcactcgtcggccaggtgatgaaggcgacgcgcggcaag
gccaacccgacgctggtgaacgagatgttgatcgagaagatcaagagcctctga

DBGET integrated database retrieval system