KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0749Help
Entry
Aaci_0749         CDS       T00985                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00010  Glycolysis / Gluconeogenesis
aac00053  Ascorbate and aldarate metabolism
aac00071  Fatty acid degradation
aac00280  Valine, leucine and isoleucine degradation
aac00310  Lysine degradation
aac00330  Arginine and proline metabolism
aac00340  Histidine metabolism
aac00380  Tryptophan metabolism
aac00410  beta-Alanine metabolism
aac00561  Glycerolipid metabolism
aac00620  Pyruvate metabolism
aac00625  Chloroalkane and chloroalkene degradation
aac00903  Limonene and pinene degradation
aac01100  Metabolic pathways
aac01110  Biosynthesis of secondary metabolites
aac01120  Microbial metabolism in diverse environments
aac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aaci_0749
   00053 Ascorbate and aldarate metabolism
    Aaci_0749
   00620 Pyruvate metabolism
    Aaci_0749
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Aaci_0749
   00561 Glycerolipid metabolism
    Aaci_0749
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aaci_0749
   00310 Lysine degradation
    Aaci_0749
   00330 Arginine and proline metabolism
    Aaci_0749
   00340 Histidine metabolism
    Aaci_0749
   00380 Tryptophan metabolism
    Aaci_0749
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Aaci_0749
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Aaci_0749
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Aaci_0749
Enzymes [BR:aac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Aaci_0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACV57793
UniProt: C8WU30
LinkDB All DBs
Position
803437..804894
Genome map
AA seq 485 aa AA seqDB search
MLDLRQLSRQYIAGEWRDGRSSRVHRDLNPFDGSTVAEIRLATVEDIDQAYRAAAEAQKV
WAQVNPFERQAVMERALQIWEGYRDEVISLVADEIGGTFIKAAIEFELVKNFLREAATYP
LRMEGRLLPATIPGKENRLLRLPAGVVGILSPFNFPMCLSMRALAPAIACGNGVVLKPHE
EAAITGGALLAKVFEEAGVPKGLVNIVVADVAEIGDAFLEHPIPRIISFTGSTAVGRHIA
EVAGRHLKRVTLELGGNSALIVLDDADLDLAVDAAVFSRFTHQGQICMCANRVIAVKDVY
ERFLGKFVERVSKLKMGSPRDPETVIGPLINRRQVERLLAVVDASIEQGARVAYRGPVDG
NVVGPVVLADVGPEMACAKEEMFGPVVAVMPVEDEEEAVRAANDSEYGLTGAVITRDVER
GVRIAMQVETGMFHVNDGTVNDEPLVAFGGEKGSGVGRYNGQWGIDEFTTLKWISIQRER
RQYPI
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatctcagacagctctcacgtcaatatatcgccggtgagtggcgcgacggacgc
agttcccgcgtgcaccgagatctgaatccgttcgacggctcgacggtcgccgaaattcgc
cttgccacggtggaagacatcgaccaggcgtaccgcgccgccgcggaggcgcagaaggtc
tgggcgcaggtgaatccgtttgaacgccaggcggtcatggagcgagccctccagatttgg
gagggctatcgagatgaggtgatctcgctcgtcgcggacgagatcggaggtacattcatc
aaggcggccattgagttcgaactggtgaagaacttcctgcgcgaggcggcgacgtaccct
ctgcgcatggaggggcggctgttgccggcgaccattcccgggaaagaaaatcgcctgctg
cgcctgcctgccggggtggtggggatcctgagcccgtttaacttcccgatgtgcttgtcg
atgcgcgctttggcgcctgccatcgcgtgtggcaacggcgttgtcctgaagccgcatgaa
gaagccgccatcacgggtggcgcgctgcttgcgaaggtgttcgaggaggcgggggtgccg
aaggggctcgtcaacatcgtcgtggctgacgtcgcggagatcggcgatgcgttcttggag
cacccgattccaagaatcatctcgttcaccggctccacagcggtcgggcggcatatcgcg
gaggtggcgggccggcacctgaagcgggtgacgctcgaactgggcggcaacagcgcgctc
atcgtgctcgacgatgccgatctcgacctcgccgtcgacgccgcggtattcagccgtttc
acgcatcagggccagatttgcatgtgcgccaatcgcgtgatcgccgtgaaggatgtgtac
gagcgatttctcgggaaatttgtcgagcgcgtgtcgaaactgaagatgggcagtcctcga
gatcccgagacggtcatcgggccgctcatcaaccgccgccaggtcgagcggctgctcgcc
gtcgtcgatgcgagcatcgagcagggcgctcgggtcgcctatcggggacccgtggacgga
aacgtggtggggccggtggtgctggccgacgtggggccggagatggcgtgcgccaaagag
gaaatgttcggccccgtggtggcggtcatgcccgtcgaggacgaggaagaggcggtgcgc
gcggccaacgacagcgagtacggtctgacgggggccgtgatcacgcgcgacgtggagcgc
ggcgtgcggatcgccatgcaggtggagacgggcatgtttcacgtaaacgacggcacggtg
aacgacgagcctctcgtggcgtttggcggcgagaagggttcgggcgtcgggcggtacaac
ggacagtggggtatcgacgagttcaccacgctcaaatggatctccattcagcgcgagcgg
cgccagtaccccatctga

DBGET integrated database retrieval system