KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1325Help
Entry
Aaci_1325         CDS       T00985                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Brite
KEGG Orthology (KO) [BR:aac00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aac01001]
    Aaci_1325
Enzymes [BR:aac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Aaci_1325
Protein kinases [BR:aac01001]
 Serine/threonine kinases: Other
  Bacterial family
   Aaci_1325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Kdo RIO1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: ACV58353
UniProt: C8WW81
LinkDB All DBs
Position
1379643..1381595
Genome map
AA seq 650 aa AA seqDB search
MTARALGGRYRLEQKIGEGGMAEVYRAIDTLLDRTVAVKMLRSQYAEDEEFVRRFRQEAQ
AAARLSHPNIVNVYDVGVEDGQQYIVMEYVDGPTLKDVIVERAPLPVEEVIRISKQICSA
LQHAHELHVVHRDIKPHNILLTKSGQVKVADFGIARAATGQTIAHRQATTVLGSVHYFSP
EQARGAPTDAKSDIYSLGVVMYEMLTGKLPFEGDSPVSVALKHLREPFVEPRQLNKDIPQ
SVENIVLRCLVKEPEGRYPNMAAVMADLDAALARPNVPKFVPSSGMDDKTIVVPAMGDRL
SEALKSAEAQGERGDPDEAHASKPPMAPWKRASLIAGIVVLSLAALGLGGYAAIVIVTRL
LTVPNVELPSVVGKPVASAVATLEAAGFSRQQIQEKFEPNLKAASGIVYQQSPAGNTQVK
KTRDITLYVSQGAPKVAVPDVTNEPLDQAKQALVSAGFSANNIVVQTETSTSVPSGDVIS
SDPAPGTQVPITSKITLTVSQQQYVTVPKLVGLTLQQAEAAIQAAGLTLGTVTPSDLVNQ
NPLVSYAYPYIQGDRVPVGSTINLYVVPNPASIPPSNGAGNATGNSANGGTQNDLDNTPS
AGNGSGADNGVSGENTGGSAANATQPTAQPAPSPQPPGHWAPGQLKHKGH
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgcgcgcgctcgggggtcggtaccgtctcgagcagaaaatcggcgaaggcggc
atggcggaagtctatcgcgccatcgatacgctcctcgatcgcacggtggccgtgaagatg
ctgcgcagccaatacgcggaagacgaggaattcgttcgccgctttcgtcaggaggcgcag
gctgctgcgcgcctttcccatccgaacatcgtcaacgtgtacgatgtgggcgtcgaggac
ggccagcagtacatcgtgatggagtacgtcgacggtcccacgctgaaggacgtgatcgtc
gagcgcgcaccgctcccggtcgaggaagtgatccgcatcagcaagcagatctgctcggcc
ttgcagcacgcgcacgagttgcacgtggttcaccgcgacatcaagccgcacaacattctc
ctgacgaagagcggccaggtcaaggtcgccgactttggcattgcccgggccgcgactggg
cagaccattgcgcatcggcaggcgacgacggtgctggggtcggttcactacttctcgccc
gaacaggcgagaggggcccccaccgacgcgaagagcgacatctattcccttggcgtcgtc
atgtatgagatgttgacgggtaaactcccgtttgagggagactcgcccgtgagtgtcgcg
ctcaagcacctgagggagccgttcgttgagccgcgccaattgaacaaagacattccgcag
agcgtggagaacatcgtcctgcgctgtttggtcaaggagccggaaggccgctaccccaac
atggccgcggtgatggccgatctcgacgctgcgctcgcgcgcccgaacgtacccaagttc
gtcccgtcaagcggcatggacgacaagaccatcgtggtgcccgcgatgggggatcgcctg
agcgaggccctgaaatccgcggaggcccagggcgaacggggcgatcccgacgaagcgcac
gcgtccaaacctccgatggcgccctggaagcgggcgagtctcatcgcgggcattgtggtt
ttgtcgctggcggcgctcggcctcggaggctacgcggctattgtgattgtaacgaggctt
ctcaccgtgccgaacgtcgagttgccgtctgtcgtcggcaagccggtggcctcggccgtg
gccacgctggaggcggcgggcttctccaggcaacagattcaggagaagtttgagcccaat
ctgaaggctgcatccgggatcgtgtatcaacagtctcctgcgggcaacacccaggtgaag
aagacgcgggacatcacgctctacgtcagccagggcgcgccgaaggtggcggtgccggac
gtgaccaatgagccgctggatcaggcgaagcaggcgctcgtgagcgccggtttctcggcc
aacaacatcgtcgttcagacggagacgagcacttctgttccgtcgggggacgtgatctcg
agcgatccggcgcccgggacgcaggtccccatcacgtcgaagatcacgctcacggtgagc
caacagcaatacgtgacggtgccgaaactcgtgggtctcacgcttcaacaggcggaggca
gcgattcaggcggccggcctgaccctgggaacggtgacaccgagcgatctcgtcaaccag
aatccgctcgtttcctacgcgtacccatacatccagggggatcgcgtgccggtgggctcg
accatcaatctgtacgtcgtgccgaaccccgcctccatcccgccgtccaatggcgcgggc
aacgccactgggaattcggcaaacggcgggacgcaaaacgacttggacaatacgccgtca
gcgggcaacggcagcggggctgacaacggcgtgtcgggcgagaataccggcggatccgcg
gccaacgccacccagcccacggctcagcctgccccttcgccgcagccgcctggccattgg
gcgcccggtcaactgaagcacaaagggcattga

DBGET integrated database retrieval system