KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1636Help
Entry
Aaci_1636         CDS       T00985                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00473  D-Alanine metabolism
aac00550  Peptidoglycan biosynthesis
aac01100  Metabolic pathways
aac01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Aaci_1636
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Aaci_1636
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Aaci_1636
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aac01011]
    Aaci_1636
Enzymes [BR:aac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Aaci_1636
Peptidoglycan biosynthesis and degradation proteins [BR:aac01011]
 Precursor biosynthesis
  Amino acid ligase
   Aaci_1636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACV58648
UniProt: C8WX26
LinkDB All DBs
Position
1707493..1708644
Genome map
AA seq 383 aa AA seqDB search
MPNRKLRVGVIFGGKSGEHEVSLQSAKSVMDALDPLHYTTIPIGISKDGRWHVGKGAWKA
LEAKQPAALPSKSAQNASSPSNRFINPEIQGLSPVEVKRSPDWLPPALVNEIDVVFPVLH
GTFGEDGTIQGLLEMVGIPYVGSGVLASALGMDKIAMKQIFSAVGIPQARWVGFTRASWA
QDDGRIVREIEEQLGYPCFVKPANLGSSVGISKARNQRELVEAVHLALSYDRRVIVEEAI
DAREIEIGILGNDDPIASVAGEIVPKREFYDYEAKYQDGGAELRIPADLSPEERKAVESY
AIRAFQAIDGSGLARVDFFVERGTGRVLVNEINTMPGFTRFSMYPKLWEASGLAYDKLLD
RLIELALERHAERSQLLRSYDKA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgccaaatcgcaaactgagggtcggcgtcatctttggtggaaagtccggtgaacacgag
gtctcgctgcagtcggccaagtcggtgatggatgcgcttgatcctctccactataccacg
atacccattgggatttcgaaggacgggcgttggcacgtcgggaagggtgcgtggaaggcg
ctcgaggcgaagcagcccgccgcattgccgagcaaaagcgctcagaacgcctcgtcccct
tccaaccggttcatcaacccggaaattcaggggctgtcacccgtcgaggtcaagcggtcg
cccgattggctccctcctgcgcttgtgaacgagatcgacgtcgtctttccggtgttgcac
ggaaccttcggcgaagacggcacaattcaggggctcttggagatggtgggcattccctac
gtaggatccggtgtgcttgcctcggccttgggtatggacaaaattgctatgaagcaaatt
ttttcggccgtgggaatcccgcaggcgcgctgggtaggattcacgcgcgcttcctgggcc
caggatgacgggcggatcgtgcgggagattgaagaacagctcggatatccctgcttcgtc
aaacccgcgaatctcggatcgagcgtcgggatctccaaagctcgaaatcagcgggaactc
gtggaggccgtccatctcgccctgtcctacgaccggcgcgtgattgtggaggaggccatt
gacgcccgcgagatcgaaatcggcattctcggcaacgacgatcctattgcgtcggttgct
ggcgagatcgtccccaagcgcgaattttatgattatgaagcgaagtatcaggacggaggc
gcggagctgcgcattcctgcagacctgtcgcctgaggagcgaaaggccgtggaatcgtac
gccatccgggccttccaggccatcgacggctcagggctggcccgagtggactttttcgtc
gagcgaggaaccggccgcgtgttggtgaacgagatcaacacgatgcccgggttcacgcgc
ttcagcatgtacccgaagctctgggaagcatccggattggcgtacgacaagttgctggac
cgcctcattgagctcgcgctggaacgacacgcggagcggagccagcttctgagatcgtat
gacaaggcgtaa

DBGET integrated database retrieval system