KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1649Help
Entry
Aaci_1649         CDS       T00985                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aac00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Aaci_1649
Enzymes [BR:aac01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Aaci_1649
DNA repair and recombination proteins [BR:aac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Aaci_1649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ACV58661
UniProt: C8WX39
LinkDB All DBs
Position
1718895..1719839
Genome map
AA seq 314 aa AA seqDB search
MPFFRPFEPISSTEVPVGDAWIAQVKWDGVRAVAEVSGDGVQIWNRHGRLRTDRYPEIAS
ALRPFRGCAFDGEVVALTQGRPDFYRVLRRDRAVASHEIEQLVREIPVWYAVFDVVRMGG
EWVGDWPLAKRLDWMLEHLSGVEHVLTSEGEVDTEALFAATKQLGLEGIVCKRVDSTYAP
GGKDGRWVKVKHERNAIAAVGGVVYRDGAPNALMLGLFDDKARLFHVGNAGAGRLPRRAW
RQLVERVLSHETSLQPFARAPKAVRTCRFAHPVVAVKVRFAEWTPKGTMRHPVLLAELDI
PATPAACSFAQADP
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgccgttctttcggcctttcgaacccatttcaagcaccgaggtgccggtgggagacgcg
tggatcgcgcaggtcaaatgggacggggtgcgcgccgtggccgaggtgtcgggcgacggc
gtgcaaatctggaaccgccacggacggcttcgaacggaccggtatccggagatcgcatcg
gcgctgcggccctttcgggggtgtgcgttcgacggcgaagtggtggcgctcacacaggga
aggcccgacttttaccgggttcttcgcagggaccgggccgtcgcgtcgcacgagatcgag
caactcgtgcgcgagatccccgtatggtacgccgtgttcgatgtcgtgcggatgggcggg
gaatgggttggggattggccattggccaagcgactcgactggatgctcgagcatctctcg
ggcgtggaacatgtgctgacgagcgaaggcgaggtggacaccgaggcgctcttcgccgcc
acaaagcaactgggactcgagggaattgtgtgcaaacgcgtggactccacctacgcgcct
ggcggcaaagacgggcgctgggtcaaagtcaaacacgagcgaaacgccatcgcggccgtt
ggcggcgtcgtgtaccgagacggcgccccgaatgcgctgatgctcggcctgtttgacgac
aaggcacggctgtttcacgtcggcaacgcgggggccggtcgcctccctcgtcgagcatgg
cgccagctcgtcgagcgagtcctctcccacgagacatcgttgcaaccgttcgcccgcgcg
cccaaggccgtgagaacgtgccgattcgcgcaccccgtcgtcgccgtgaaggttcgcttc
gccgaatggacgccaaaagggaccatgcgccaccctgtcctcctcgccgagttggatatc
ccggcgacgcccgcggcgtgcagttttgcccaggccgacccgtga

DBGET integrated database retrieval system