KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2136Help
Entry
Aaci_2136         CDS       T00985                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00620  Pyruvate metabolism
aac00680  Methane metabolism
aac01100  Metabolic pathways
aac01120  Microbial metabolism in diverse environments
aac01200  Carbon metabolism
Module
aac_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Aaci_2136
  Energy metabolism
   00680 Methane metabolism
    Aaci_2136
Enzymes [BR:aac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Aaci_2136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: ACV59145
UniProt: C8WQK0
LinkDB All DBs
Position
complement(2193883..2196603)
Genome map
AA seq 906 aa AA seqDB search
MANDAPLHRDIRVLGDLLGEVLVEQCGRRVFDHVESIRLAAKAFRADPSPETRAALQAAV
SAVEPEHRNDVIHAFSVYFQLVNLAEQNHRLRRHRDYDRSQQVLRGSFRETMRTLADRGM
TADDIESLLREVGIELVLTAHPTEALRRTVLDKHTKIAAFLEDMDDPRKTPRELDVLRER
IRTEIVALWQTRSVRKQRITVLDEVRNGLYFLDQILFDVLPRVHQKLEQAVEEQFGRQLL
ELPPLIRFGSWMGGDRDGNPNVTSDITWQTLVLHCDLALNKYEQKLRELGRDLSVSVDRA
GADEDLLASLGGENDEPYRALINRMLERLANTRRRLHGERVDGPDYASPEAMMEDVERMA
RSLAHHRGQRMVDAWLRPFLLQLRIFGFHMVTLDIRQHSGVHEQAVAELLQTAGLVDDYT
SLGEEERVRVLSECLASPRPIRNPYHVYSDVTTEALAVLDCVRRGHETFGPRCVQDYLIS
MTQGASDLLEVLLLAKESGLFGWPDGPMAPPKSDLNVVPLFETIEDLESAAGIMRSLFEN
PVYRRHLEMRGWQQEIMLGYSDSNKDGGYLTANWSLYMAQKHLIRLAEAYGVRIKFFHGR
GGALGRGGGPVEQSILAQPTEALRGHVKITEQGEVISQRYGHPGIAERSLESSAAAVLVG
ATREDSEEWAERHPRWFRLLDRASEISFRAYRKLVFEHPAFLEYFHRATPIDEIGKMNIG
SRPSRRSQSARIEDLRAIPWVFSWTQSRHLLPAWYGFGSAIEAIMREDPRALEDLRRMYE
VWPFFRTLVDNLQMALAKADMLVAKEYAQLAGEAGEAVFPLIEEEYARTERAVLDITGYR
QLLDNRPVIRESISLRNPYVDPLSFFQVRLLADLRTDNLSPEEREAELADALQTINGIAA
GLRNTG
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaacgacgcacccttgcaccgggacatacgcgtcctcggggatttgttgggagaa
gtgctggtcgagcagtgcggccggcgcgtcttcgatcacgtcgaatccattcgcctcgct
gccaaggcctttcgcgcggacccgtcgcccgaaacgcgcgcggcgctgcaggcggccgtg
tccgccgtggagcccgagcaccggaacgacgtgattcacgcgttttcggtctactttcag
ttggtcaacctcgcggagcaaaaccacaggcttcgccgccaccgagattacgatcgctcg
caacaggtgctgcgcgggtcgtttcgcgaaaccatgcgcaccctggccgatcgcggcatg
accgccgacgacattgagtccctgcttcgggaggtcgggatcgagctcgtgctcaccgcg
catcccaccgaggcgctgcgccgcaccgtgctcgacaaacacacgaagatcgcggctttc
ctcgaggacatggacgatccgcgcaagacgccgagagagctcgacgtgctgcgcgagcga
attcgcaccgagatcgtcgcgctgtggcaaacgagatcggtgcgcaagcagcgcatcacc
gtgctggatgaggtccgaaacgggctgtactttctggaccagatcctgttcgacgtcctt
cctcgcgtgcatcaaaagctcgaacaggcggtcgaggaacagtttggtcgtcagcttctc
gaactgcccccgcttattcgcttcggctcgtggatggggggcgatcgcgacggcaatccg
aacgtcacgtccgacatcacctggcagacgctcgtcctccactgcgatctcgccctcaac
aaatatgagcaaaagttgcgagaactcgggcgcgatctgagcgtgtccgtggaccgggcg
ggcgcggacgaggatctcctggcttccctgggaggcgaaaacgacgagccgtaccgggcg
ctcatcaaccggatgctggagcggctcgccaacacgcggcgccggctgcacggggagcgg
gtggacggtcccgattacgcgtcacccgaagcgatgatggaggacgtcgaacggatggcg
agatcgctcgcgcatcaccggggccagcgcatggtggatgcgtggttgcgcccgttcctg
ctgcagcttcgcatcttcggcttccacatggtgacgctcgacatccgtcagcactccggc
gttcatgagcaggcggtggcggagctcttgcagacggcgggcctcgtggacgactacacg
tcgcttggcgaggaagagcgcgtgcgcgtcctgtccgaatgccttgcgtcgccgcgcccc
attcgcaatccgtatcacgtgtactccgatgtcaccacggaggcgctcgcggtcctcgac
tgcgtgcggcgagggcacgagaccttcgggcctcgctgcgtgcaggactacctcatttcc
atgacgcaaggcgcgagcgacctgcttgaggtgttgctcttggcgaaggagtccggcttg
ttcggctggccggacgggccgatggcgccgcccaagagcgacttgaacgtcgttccgctg
tttgagaccatcgaggacctggagtccgcggcggggatcatgcggtcgctgtttgaaaac
cccgtgtatcggcgtcacctggagatgcgcggctggcagcaggagatcatgctcgggtat
tccgacagcaacaaggacggcggctatctcaccgccaactggtcgctgtacatggctcaa
aagcacctgattcgcctggcggaagcgtacggcgtgcgcatcaagttctttcacggccgg
ggcggcgcgctggggcgagggggcggtcccgtggagcagagcattctcgcccagcccacg
gaggcgctccgagggcacgtgaagatcacggagcagggcgaggtcatctcgcagcggtat
ggacacccgggcatcgccgaacgctcgcttgagtcctcggcggcggctgtgctggtgggc
gccacgcgagaggacagcgaggagtgggcagagcgccatccgaggtggtttcggcttttg
gaccgagcgtcggaaatcagcttccgcgcctaccggaagctggtcttcgagcatcccgcg
ttcctcgagtatttccatcgggcgacgcccattgacgagatcggcaagatgaacattggg
tcgaggccttcgcggcgctcgcagtcggcgcgaatcgaggacctgcgggccatcccctgg
gtgttctcgtggacgcagagccgccacctgctgcccgcctggtacggcttcggcagtgcg
atagaggccatcatgcgggaggaccctcgcgcgcttgaagaccttcgccgcatgtacgag
gtgtggccgttcttccggacgctggtcgacaatcttcagatggcgctcgccaaggcggat
atgctcgtggcgaaggaatacgcgcagttggcgggggaggcgggagaggccgtctttccg
ctgattgaggaggagtacgcgcgcacggagcgcgccgtgctcgacatcacgggctaccgg
cagcttctcgacaacaggccggtcatacgggagtccatctcgcttcgcaacccgtatgtc
gatccgctgtcgttcttccaggtgcgcctgttggccgatctgcgcacggacaacctgtcg
cccgaagagcgcgaggcggagctggccgacgcgctgcagaccattaacggcatcgccgcg
ggcctgcgcaataccggctga

DBGET integrated database retrieval system