KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2518Help
Entry
Aaci_2518         CDS       T00985                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Brite
KEGG Orthology (KO) [BR:aac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Aaci_2518
Enzymes [BR:aac01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Aaci_2518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like AlaDh_PNT_C DAO FAD_oxidored FAD_binding_3 Glutaredoxin Thi4 K_oxygenase NAD_binding_8 FMO-like Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ACV59523
UniProt: C8WT08
LinkDB All DBs
Position
complement(2586296..2587825)
Genome map
AA seq 509 aa AA seqDB search
MVLDDEIREQLKQYLELMEGDVVIRVAPGSDDASRDMMELVNELKSMSPKIHVEEADLPR
RPSFSVNRPGEDTGIVFAGAPLGHEFTSLVLALLQVSGRPPKVDESVIRKIQSLEGTYEF
ETYVSLSCHNCPDVVQALNLMSVLNPNIRHTMIDGAVFKSEVEEKNVMAVPTVYLNGEFF
ESGRMSVEEILAKLGSQADVSELNARDPYDVLVIGGGPAGASAAIYAARKGIRTGIVVDR
FGGQVNDTLGIENFISVKYTEGPKFAAQLEEHVRHYNIDIIKSQRAKQLRKGDLIEVDLE
SGATLKSKTVIIATGARWRNLGVPGEKELQTKGVAYCPHCDGPLFQGKRVAVIGGGNSGI
EAAIDLAGLASHVTVLEFLPQLKADEILQKRLFSLPNVTVLTNVETKEILGTERVTGIRY
ADRATGEEHQLELEGVFVQIGLVPNTEWLGDFVEKTRFGEIVVDSRGQTSVEGVFAAGDC
TNVPYKQIIISMGSGATAALGAFDYLIRH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcgacgatgaaattcgagagcaactgaaacagtatctcgagctcatggaaggc
gacgtcgtgatccgggttgcgcccgggtccgacgacgcctcccgcgatatgatggagctc
gtgaacgaattgaaatcgatgtcgcccaagattcacgtggaagaggctgatcttccgcgg
cgtccgagcttcagcgtgaaccgcccgggcgaggacacgggcatcgtgtttgccggcgca
ccacttggacacgagttcacatcgctcgttctggcgcttttgcaggtgagcggtcggccg
cccaaggttgatgagtcggtcatccgcaagattcagagcctcgagggcacgtacgaattc
gagacgtacgtcagcttaagctgccacaactgcccagacgtggtgcaggccctcaacctg
atgagcgtgctgaatccgaacatccggcacactatgatcgacggcgccgtgttcaagtcg
gaagtggaagagaagaacgtgatggcggtgccgacggtgtatctcaacggggagttcttc
gagagcgggcgcatgtccgtggaggaaatcctcgcgaagctcggcagccaagcggatgtc
tccgaactgaatgcgcgcgatccgtacgatgtcctggtgattggcggcggccccgcgggc
gcgagtgcggccatttacgcggcccgcaagggcatccgaactggcatcgtggtggatcgg
ttcggcggccaggtgaacgacacgctcggcatcgagaacttcatcagcgtgaagtacacc
gaagggccgaaattcgccgcccagcttgaggaacatgtccgtcattacaatatcgacatt
atcaaatctcaacgcgcgaaacaattgcgaaaaggcgatctcatcgaggtcgatctcgaa
agcggcgcgacactcaagtcgaagacggtcatcatcgcgacaggtgcccgctggcgcaac
ctcggcgtccctggcgagaaggagttgcagaccaagggtgtagcctactgcccgcactgc
gacggcccgctcttccagggcaagcgcgtggccgtgatcggcggcggcaactctggcatt
gaggcggccatcgatctcgccggcctcgcgtcgcacgtcaccgtgctcgagtttttgcct
cagctcaaggcggatgagatcttgcagaagcggctgttcagtctgcccaacgtcacggtg
ctcacgaacgtcgagacgaaggagattctcggcacggagcgcgtgacgggaattcgctat
gccgatcgcgccacgggcgaggagcaccagctggagctcgaaggcgtgttcgtgcaaatc
ggcctcgtgccgaacacggagtggctcggcgatttcgtcgagaagacgcggttcggcgaa
attgtcgtcgacagccgcggccagacgagcgtcgagggcgtgtttgcggcgggcgactgc
accaacgtgccgtacaagcagatcatcatctccatgggctctggcgcgacggccgcgctc
ggcgcgttcgattacctgatccgtcattga

DBGET integrated database retrieval system