KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2581Help
Entry
Aaci_2581         CDS       T00985                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00330  Arginine and proline metabolism
aac01100  Metabolic pathways
aac01110  Biosynthesis of secondary metabolites
aac01130  Biosynthesis of antibiotics
aac01230  Biosynthesis of amino acids
Module
aac_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Aaci_2581
Enzymes [BR:aac01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     Aaci_2581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored ApbA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ACV59585
UniProt: C8WT71
LinkDB All DBs
Position
complement(2662654..2663472)
Genome map
AA seq 272 aa AA seqDB search
MKRLFILGAGSMAESFIKGIVEEGVIDPRDIFVCNRSRRERLLELSEWYGITPADSMARA
ADTDLVILAVKPYDMMEALKQLRPYLSNQVLLSFAAGIPIDAIRRATGGHPYVIRTMPNV
PVAVMQGAIALSAPPTVPRDKLRRVVEMLAGLGQVVEIEEGLMDAATAFSGSGPGFISYL
LEAMEQAAVELGFAPELARRLLVQTVIGTAHVLREWDLSPSELRRRVTSPNGTTHAGVEV
MQSRGVYEAIVEAVRRAAVRAEEMGREYTREG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcggcttttcatcctcggagccggttcgatggccgagtcgtttatcaaaggcatc
gtggaagagggcgtgatcgacccgcgggacatcttcgtctgcaatcgatcgcgccgcgaa
cggttgttggaattgagcgaatggtatggcatcacgcccgccgactcgatggcacgggcg
gcggacacggatctggtgattctcgcggtgaagccgtacgacatgatggaagctttgaaa
caactgcggccctacctgtcgaatcaggtgcttctgtcgtttgccgcaggcatccccatc
gacgccattcggcgcgcgaccggaggtcacccgtacgtcatccgcaccatgccgaacgtg
ccggtggcggtgatgcagggcgccatcgcgctgtcggcgccgcccacggtgccaagggac
aagcttcgccgcgtcgtcgagatgctggccggcctcgggcaggtggtggagattgaggag
gggctgatggacgccgccaccgcgttttcgggcagcggtccggggttcatcagctatctc
ctcgaggcgatggagcaggcggccgtggaactcggcttcgccccggagctcgcgcggcgg
ctcttggtgcagaccgtcatcggcacggcgcacgtcctgcgcgagtgggacctgagcccg
agcgaattgcgccgccgcgtgacctcgccgaacggcaccacgcacgccggtgtcgaggtg
atgcaatcgcgcggggtgtacgaggctatcgtcgaggcggtgcggcgggcggccgttcgc
gcggaggagatggggcgcgagtacacgcgcgagggctga

DBGET integrated database retrieval system