KEGG   Acetobacter aceti: A0U92_03010Help
Entry
A0U92_03010       CDS       T04735                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
aace  Acetobacter aceti
Pathway
aace00473  D-Alanine metabolism
aace01100  Metabolic pathways
aace01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aace00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A0U92_03010
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A0U92_03010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aace01011]
    A0U92_03010
Enzymes [BR:aace01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A0U92_03010
Peptidoglycan biosynthesis and degradation proteins [BR:aace01011]
 Precursor biosynthesis
  Racemase
   A0U92_03010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AQS83906
UniProt: A0A1U9KDQ3
LinkDB All DBs
Position
672676..673830
Genome map
AA seq 384 aa AA seqDB search
MDVAAQWAGGILNIDLQAVAKNYRTLCQVIQRPDQTSGPHPICAAAVKADAYGLDASLVA
PVLEDAGCRHFFVAHLAEGVALRPSVKNPQSSILVLHGPPPGTARDLHEAGLVPVINSME
QLAEWRALGRVLERRLPAVLQVDSGMARFGMNAGEVAKIAADPALLDGIRTMLVMSHLAC
ADTPEVSSNQAQLEAFRHLSASLPDAPRSLAASSGIFLGPDWHFDLVRPGAALYGVNPTP
GKPSPVSPVIRLQARVIQTRAVPRGQAVGYGGGFVARRPSRIALLGIGYGDGFLRSISNQ
GTAILPSQPDVPLPVIGRVSMDSLAVDITDLEDGRVRAGELIDLIGPYNTLDAAATAAGT
IGYEFLTDLGRRYHRTYTRNDPLV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggacgtagcagcgcaatgggctggcggcattctgaatatcgatcttcaggctgtcgcg
aagaattatcgcacgctgtgtcaggtcattcagcgaccggaccagacatcgggtccacac
ccgatctgcgccgccgccgtgaaagcggacgcctacggacttgatgcttctctcgtcgcg
cctgtccttgaggatgccggttgtcggcatttttttgtcgcgcatcttgccgaaggcgtg
gcgctgagaccctctgtcaaaaaccctcagtcttccatcctggtgctccatgggccacct
cccggcacggcgcgcgacctgcatgaggccggactggtgccggtcatcaacagcatggag
cagttggcggagtggcgtgcgttggggcgggtattggaacgccgtcttcccgctgtgttg
caggttgattccggtatggcccggtttggcatgaatgccggagaggtcgcgaagatcgcg
gcggacccggcgcttcttgatggcatcaggacgatgctggtgatgagccaccttgcctgc
gccgacacgcccgaagtttcgagtaaccaggcgcaactggaagcattccggcatctcagc
gcctccctgccggatgcgccgcgtagtctggcggcttcctcgggcatctttcttggtccg
gactggcactttgatctcgtccggcccggggccgccctgtatggcgtcaatccgacaccg
gggaaacccagtcccgtcagtcctgtcatccgcctgcaggcgagggtcatccagacccgc
gcggtcccgagagggcaggcggtgggatatggcggtggtttcgttgcgcgtcgccccagc
cggatcgccttgctcggcatcggatatggcgacggatttctgcgcagtatttccaatcag
ggtacggccatactgccatctcagcccgatgtcccgctgccggtcatcggacgcgtttca
atggactcgcttgccgtcgacatcacggatcttgaggacggtcgggtcagggcaggggaa
ctgatcgacctgatcgggccgtataacacgctggacgctgcggcgactgcggcaggaacg
atcggttacgaatttttgaccgacctcggcagacgttatcatcgcacctatacgagaaac
gatccattggtgtga

DBGET integrated database retrieval system