KEGG   Acetobacter aceti: A0U92_13420Help
Entry
A0U92_13420       CDS       T04735                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
aace  Acetobacter aceti
Pathway
aace00020  Citrate cycle (TCA cycle)
aace00190  Oxidative phosphorylation
aace00650  Butanoate metabolism
aace01100  Metabolic pathways
aace01110  Biosynthesis of secondary metabolites
aace01120  Microbial metabolism in diverse environments
aace01130  Biosynthesis of antibiotics
aace01200  Carbon metabolism
Module
aace_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aace00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A0U92_13420
   00650 Butanoate metabolism
    A0U92_13420
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A0U92_13420
Enzymes [BR:aace01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A0U92_13420
    1.3.5.4  fumarate reductase (quinol)
     A0U92_13420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AQS85606
UniProt: A0A1U9KIM5
LinkDB All DBs
Position
2967983..2969794
Genome map
AA seq 603 aa AA seqDB search
MNANSSPSRGAYRIVDHAYDVVVVGAGGSGLRATLGMGAAGLSTACVTKVFPTRSHTVAA
QGGIGASLGNMAEDNWRWHMYDTVKGSDWLGDQDAIEFMCREAVPAVHELEHFGVPFSRT
EQGKIYQRPFGGHMSDFGKAPVPRACAAADRTGHAILHTLYQQCLKHNVEFFVEYFAIDL
IMDEEGACRGVMAWCQDDGTIHRFNAKMVVLATGGYGRAWQSCTSAHTCTGDGGGMVMRA
GLPTQDMEFVQFHPTGIYPAGCLLTEGCRGEGAYLTNSEGERFMERYAPTAKDLASRDVV
SRAMTVEIKEGRGCGTKKDHIMMHLEHLGSDLLHERLPGIIETSRIFAGVDVTKEPVPVL
PTVHYNMGGIPTNIHGEVVRPTDDNPDAVVPGLMAVGEAACVSVHGANRLGTNSLLDLIV
FGRAAAKRAAEIVKPADFVKPLPAGAGEYALDRLDRIRYAKGDTRVSELRDRLQRDMQTH
AAVFRTEESMKEGCDKIQEIWKAKDDMSVADRSLIWNSDLMEALEFENLLGNATATLESG
LVRHESRGAHARDDYPDRDDKEWMKHSVSWLDDKGGTKMTYRPVHMKTLTDEVQVFPPKK
RVY
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctaattcctctccttcccggggggcctaccgcattgtcgatcacgcctatgac
gtggtcgtggtcggcgccggcgggtcgggtctccgtgcaacgctgggtatgggcgccgct
ggcctgtccactgcctgcgtcacgaaagttttccccacacgcagccatacggtcgcagca
cagggcggcattggcgcctcccttggcaacatggccgaggataactggcgctggcacatg
tacgacaccgtgaaggggtcggactggctgggcgatcaggacgcgatcgagttcatgtgc
cgcgaggcggtccccgccgtgcatgaactcgaacatttcggcgtgccgttctcccgcacc
gaacagggcaagatctatcagcgccccttcggtggtcacatgagcgacttcggcaaggct
ccggtgccccgcgcctgcgccgccgccgaccgcacgggccatgcgatcctgcacacgctg
tatcagcagtgcctgaagcataacgtcgagttcttcgtcgaatatttcgccatcgacctc
atcatggatgaggaaggcgcgtgtcgcggcgtgatggcatggtgtcaggacgacggcaca
atccatcgcttcaacgcgaagatggtcgttctggcgaccggcggctacggtcgcgcctgg
cagtcctgcacctcggcccacacctgcacgggtgacggcggcggcatggtcatgcgcgct
ggtctcccgacacaggatatggagttcgtgcagttccatcctaccggcatctatccggcg
ggctgcctgctgaccgaaggctgccgtggtgaaggcgcctatctgaccaactccgaaggt
gagcgcttcatggagcgttatgcgccgacggcgaaggatctggcgtcccgtgacgtggtc
tcccgcgccatgacggtcgagatcaaggaagggcgtggttgcggcacgaaaaaagaccac
atcatgatgcatctggagcatctcggctccgatctgctgcatgagcgtctgccgggcatc
atcgaaacgtcacgcatctttgccggtgtggacgtgacgaaggagccggtaccggttctg
ccgaccgttcactacaacatgggcggtatcccgacgaacattcacggtgaagtggtccgt
ccgacggacgacaacccggatgccgtcgttcccggcctgatggccgtgggtgaagcggcg
tgcgtgtccgtgcatggcgcgaaccgtcttggcaccaactcgctgctcgatctgatcgtc
tttggtcgcgccgccgccaagcgcgccgccgagatcgtcaagccggctgatttcgtgaag
ccgctgcctgccggcgccggcgagtatgcgctggatcgtctcgatcgcatccgttacgcg
aaaggcgacacacgcgtctccgagctgcgtgaccgtctccagcgcgacatgcagacccat
gccgccgtgttccgcacggaagagagcatgaaggaaggctgtgacaagattcaggaaatc
tggaaggccaaggacgacatgtccgtcgccgaccgttccctgatctggaacagtgacctg
atggaagccctcgagttcgagaaccttcttggcaacgcgacggcgacgctggaaagcgga
ctggtccgtcacgaaagccgtggcgcccatgcccgtgacgattatccggaccgtgacgac
aaggaatggatgaagcacagcgtatcgtggctggacgacaagggcggcacgaagatgacc
tatcgccccgtgcacatgaagaccctcaccgacgaggttcaggtcttcccgcccaagaag
cgcgtctactaa

DBGET integrated database retrieval system