KEGG   Acetobacter aceti: A0U92_13425Help
Entry
A0U92_13425       CDS       T04735                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
aace  Acetobacter aceti
Pathway
aace00020  Citrate cycle (TCA cycle)
aace00190  Oxidative phosphorylation
aace00650  Butanoate metabolism
aace01100  Metabolic pathways
aace01110  Biosynthesis of secondary metabolites
aace01120  Microbial metabolism in diverse environments
aace01130  Biosynthesis of antibiotics
aace01200  Carbon metabolism
Module
aace_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aace00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A0U92_13425
   00650 Butanoate metabolism
    A0U92_13425
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A0U92_13425
Enzymes [BR:aace01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A0U92_13425
    1.3.5.4  fumarate reductase (quinol)
     A0U92_13425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer2 Fer4_7
Motif
Other DBs
NCBI-ProteinID: AQS85607
UniProt: A0A1U9KIM1
LinkDB All DBs
Position
2969822..2970604
Genome map
AA seq 260 aa AA seqDB search
MVELRLPRNSTVGKGQLFPAPAGSKNVRTFKIYRWTPDDDSNPVMDTYEIDIDTIGPMVL
DALIHIKNDVDPTLTFRRSCREGICGSCAMNIDGENTLACLKPIKDMQGDIIINPLPHMP
IVKDLVSNLDGAYAQLRSIEPWMKADSAPPPDGERLQSPEERAKLDGMWECILCFCCTTS
CPSYWWNGDRYLGPATLLAAYRWIADSRDEHQGDRLDSLEDTFKLYACRTIMNCTQTCPK
GLNPAKAIGRIKELQVERKL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaactgagacttccgcgtaacagcacggtgggcaaggggcagctctttcctgcc
cccgccggctccaagaatgtgcggactttcaagatctatcgctggacgccggatgacgac
agcaatccggtgatggacacctatgagatcgacatcgacaccatcggcccgatggttctc
gatgcgctgatccacatcaagaacgacgtcgatccgacgctgacgttccgccgctcctgc
cgtgaaggcatctgtggttcctgcgcgatgaatatcgacggcgagaatacgctcgcgtgc
ctcaaaccgatcaaggacatgcagggggatatcattatcaatcccctcccccacatgccc
atcgtgaaggatctggtgtccaacctcgacggtgcgtatgcccagttgcgctccattgag
ccgtggatgaaggccgacagcgcgccaccgccggatggcgagcgtctccagtcacccgaa
gagcgcgccaagctggacggcatgtgggagtgcatcctgtgcttctgctgcacgacctcc
tgcccgtcctactggtggaacggcgaccgttaccttggtccggccacgctgctcgcggcc
tatcgctggatcgcggacagccgtgacgagcatcagggcgaccgtctcgactcgctggaa
gacaccttcaagctctatgcgtgccgcacgatcatgaactgcacgcagacctgcccgaaa
ggtctcaatcccgccaaagccattggccggatcaaggagctacaggtcgagcgcaagctc
tga

DBGET integrated database retrieval system