KEGG   Acidipropionibacterium acidipropionici CGMCC 1.2230: ASQ49_05635Help
Entry
ASQ49_05635       CDS       T04523                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aaci  Acidipropionibacterium acidipropionici CGMCC 1.2230
Pathway
aaci00010  Glycolysis / Gluconeogenesis
aaci00030  Pentose phosphate pathway
aaci00051  Fructose and mannose metabolism
aaci00052  Galactose metabolism
aaci00680  Methane metabolism
aaci01100  Metabolic pathways
aaci01110  Biosynthesis of secondary metabolites
aaci01120  Microbial metabolism in diverse environments
aaci01130  Biosynthesis of antibiotics
aaci01200  Carbon metabolism
aaci01230  Biosynthesis of amino acids
aaci03018  RNA degradation
Module
aaci_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aaci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASQ49_05635
   00030 Pentose phosphate pathway
    ASQ49_05635
   00051 Fructose and mannose metabolism
    ASQ49_05635
   00052 Galactose metabolism
    ASQ49_05635
  09102 Energy metabolism
   00680 Methane metabolism
    ASQ49_05635
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ASQ49_05635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aaci01009]
    ASQ49_05635
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:aaci03019]
    ASQ49_05635
Enzymes [BR:aaci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ASQ49_05635
Protein phosphatases and associated proteins [BR:aaci01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ASQ49_05635
Messenger RNA biogenesis [BR:aaci03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ASQ49_05635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ALN16745
UniProt: A0A1P8U3F5
LinkDB All DBs
Position
complement(1281903..1284152)
Genome map
AA seq 749 aa AA seqDB search
MFDRTSRTPTLPDGRGIRIGILTSGGDAQGMNAAVRAVVRSAISVGAEVYAIYEGYQGMI
DGGEGIRKFGWDDVGSILNRGGTVIGTFRSKEMREREGRLKAVRHLLHRGIDRLVVIGGD
GSLTGLNLLRNEWSGLVAELVERGDLAPEVAEQHPSLMIAGLVGSIDNDLVGSDMTIGAD
TALHRIVDAIDDLASTAASHQRSFVVEVMGRHCGYLALMSAVAGGADYVLVPEQPPAPGW
EDEMCAELRKGRESGRRDSIVIIAEGATDREGNPIRAEYVRKVLAERLNEDARVTILGHV
QRGGKPSAYDRWASTWLGYSAVHEVLTATPESEGMVVGTRSNRSERLSLVKAVADTQHVP
ELIEAGQYHEAMRMRGGSFLEMDAIFSELADPARTTPEPDYRRIAVMHAGGPAPGMNTAM
RALVRLGISRGHTMIGIHNGFVGLAANDMEEITWSQVEGLTGEGGAMLGTRREVPQTQDL
YAISRALEKNDIDALVVIGGYSAYDGVHKMTTERDRYPAFRIPTVCVPASIDNNLPGSEL
SIGTDTALNVIVDAMDKIKESGIASKRCFVVETMGKNCGYLAMMSGIAAGAERIYLNEDG
ISLDDLVTDVHWLRESFAKGRRLFLAVRNENASKNYTTEFLAQMMEEESHGMYDVRTAVL
GHMQQGGSPSPFDRLLATRFSYQALNLVDDELAVGQDGSWFMGIREGSTHAGKMETMSSL
VDPQHRRPRHQWWLDLRTVARTLSDELRS
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atattcgaccggacctcccggacgccgaccctccccgacggcaggggaatacggatcggc
atcctcaccagcgggggcgacgcccagggcatgaatgccgcggtccgcgccgtggtgcgc
tcggccatcagcgtgggcgccgaggtctacgccatctacgagggctatcaggggatgatc
gacggcggcgagggcatccggaagttcggctgggacgacgtcggctccatcctcaatcgc
ggcggcaccgtcatcggcaccttccggtcgaaggagatgcgcgagagggagggccggctc
aaggccgtccggcatctgctgcaccggggcatcgaccgcctcgtcgtcatcggcggagac
gggtcgctgaccggcctgaacctgctgcgcaacgagtggtccgggctggtggccgaactt
gtggagcgcggcgacctggcacccgaggtcgccgagcagcaccccagcctgatgatcgcc
ggcctggtgggctccatcgacaacgacctggtgggctccgacatgacgatcggcgccgac
accgcgctgcaccgcatcgtcgacgccatcgacgacctggcgtccaccgccgccagccac
cagcgctccttcgtcgtggaggtgatgggacgccactgcggctacctggctctgatgagc
gccgtcgccggcggggcggactacgtcctggtccccgagcagcctccggcgccgggctgg
gaggacgagatgtgcgccgagctgcgcaagggccgcgagtcggggcgccgcgactccatc
gtcatcatcgccgagggagcgaccgatcgcgagggcaacccgatcagggccgagtacgtc
cgcaaggtgctggccgaaaggctcaacgaggacgcccgggtcacgatcctggggcacgtc
cagcgcggcggaaagcccagcgcctacgaccgctgggcctcgacctggctgggctactcc
gccgtccacgaggtgctcaccgccacccccgagtccgaggggatggtcgtcggcacccgg
tcgaaccgctccgagcgactctcactggtcaaggcggtggccgacacccagcacgttccc
gagctcatcgaggccggccagtaccacgaggccatgcggatgcgcgggggctccttcctc
gagatggacgccatcttctccgagctggcggatccggcgcgcaccacgcccgaacccgac
tacaggaggatcgccgtgatgcacgccggggggccggcgccgggcatgaacacggccatg
cgggccctcgtgcgactgggcatctcccgtggtcacaccatgatcggaatccacaacggg
ttcgtcggcctggccgccaacgacatggaggagatcacctggagccaggtggaggggctc
accggcgagggcggcgcgatgctcggcacacgccgcgaggtaccccagacccaggacctg
tacgcgatcagccgggccctggagaagaacgacatcgacgcgctggtggtgatcggcggc
tattcggcctatgacggcgtccacaagatgacgacggagcgggaccgctaccccgccttc
cggatccccaccgtctgcgtgcccgccagcatcgacaacaaccttcccggctcggagctg
tcgatcggcaccgacaccgctctgaacgtcatcgtcgacgccatggacaagatcaaggag
tccggtatcgcctccaagcggtgcttcgtggtggagacgatgggcaagaactgcggctac
ctcgcgatgatgagcggcatcgcggccggcgccgagaggatctacctcaatgaggacggc
atcagcctggacgatctggtcaccgacgtccactggctgagggagtccttcgcgaaggga
cgccggctcttcctggcggtgcgcaacgagaacgcctcgaagaactacaccaccgagttc
ctcgcccagatgatggaggaggagtcccacgggatgtacgacgtgcgcaccgccgtgctc
ggccacatgcagcagggagggtcgccctcccccttcgaccggctgctcgccacccggttc
agctaccaggcgctcaacctggtggacgacgagctcgcggtcggccaggacggctcctgg
ttcatggggatccgggagggcagcacccatgccgggaagatggagaccatgtcctccctg
gtcgaccctcagcaccggcgaccgcgccaccagtggtggctggacctgcgcacggtggcg
cggaccctctctgatgagctcaggagctga

DBGET integrated database retrieval system