KEGG   Acidipropionibacterium acidipropionici CGMCC 1.2230: ASQ49_06665Help
Entry
ASQ49_06665       CDS       T04523                                 

Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
aaci  Acidipropionibacterium acidipropionici CGMCC 1.2230
Pathway
aaci00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aaci01100  Metabolic pathways
aaci01110  Biosynthesis of secondary metabolites
aaci01130  Biosynthesis of antibiotics
aaci01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aaci00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ASQ49_06665
Enzymes [BR:aaci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     ASQ49_06665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT
Motif
Other DBs
NCBI-ProteinID: ALN15013
UniProt: A0A1P8TYK9
LinkDB All DBs
Position
1531519..1532475
Genome map
AA seq 318 aa AA seqDB search
MLGYFGPAGTFTHQALRTLGTGDARPFSSVVSAITAAAAGEVEASLVPIENSVEGGVSAT
LDTLAAVGGLQIIREVVIPVQFGLYVRPGSTLADVTSVLTHPHAAAQCRGWLDAHLPKGA
DITEGGSTAGAAKEVSDPFSRYDAAICAPVAADMYNLVPAAERIGDNANAVTRFVLVGRR
GPVAARTGDDRTTVVAFMHEDHPGALLDILQQFAFRGINLSRIESRPTKDQLGSYCFSID
AVGHIDDERMAAALKGLHRVCSEVTFLGSYPHAVVDGSPAPVQPPAPAGSTDRAYREAEA
WFAEVTGRSVEQQSHVAD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggatacttcggtcccgccgggaccttcacccatcaggcgctgcggaccctcgga
accggcgatgcccggcccttctccagcgtcgtctcggcgatcacggccgccgccgcgggt
gaggtggaggcctccctggtgccgatcgagaactcggtggagggcggcgtcagcgccacc
ctggacaccctcgcggcggtgggcgggctccagatcatccgcgaggtcgtcatccccgtc
cagttcgggctgtacgtgcgccccggctccaccctggccgacgtcaccagcgtcctgacc
catccgcacgcggcggcccagtgccgcggatggttggacgcccacctgcccaagggggcc
gacatcaccgagggcggctcgacggccggcgccgccaaggaggtctccgaccccttctcc
cgctacgacgccgcgatctgcgccccggtcgccgccgacatgtacaacctcgtcccggcc
gccgagaggatcggcgacaacgcgaacgcggtgacccgcttcgtactggtcggacgccgt
ggcccggtcgcggcccgcaccggcgacgaccgcaccaccgtcgtcgccttcatgcacgag
gaccatcccggcgcactcctcgacatcctccagcagttcgccttccgcgggatcaacctg
tcgcgcatcgagtcgcgccccaccaaggaccagctcggcagctactgcttctccatcgac
gccgtcggccacatcgacgacgagcggatggccgccgccctcaagggcctgcaccgggtg
tgctccgaggtgaccttcctcggctcctacccccacgccgtcgtcgacggcagccccgcg
cccgtccagcctccggcccccgccgggtcaaccgaccgcgcctaccgggaggccgaggca
tggttcgccgaggtgaccggccgcagcgtcgagcagcagagtcacgtcgcggactga

DBGET integrated database retrieval system