KEGG   Acidipropionibacterium acidipropionici CGMCC 1.2230: ASQ49_07020Help
Entry
ASQ49_07020       CDS       T04523                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
aaci  Acidipropionibacterium acidipropionici CGMCC 1.2230
Pathway
aaci00040  Pentose and glucuronate interconversions
aaci00051  Fructose and mannose metabolism
aaci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ASQ49_07020
   00051 Fructose and mannose metabolism
    ASQ49_07020
Enzymes [BR:aaci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     ASQ49_07020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ALN15061
UniProt: A0A1P8TYN6
LinkDB All DBs
Position
complement(1608137..1609186)
Genome map
AA seq 349 aa AA seqDB search
MTETMTAAVMHAVGDIRIEEVPKPVAGPGEALLKVAACGVCGSDLARMFLKGPHKLPLIC
GHEFSAWVEEVGEGVTSVKPGDLVTVPPMLPCFKCPPCVQGEFSLCEDYDYYGSRRDGAY
AEYVAGPADLLLKAPEGLDPRAAAMVDPSAIALHAIWRTKLRAGQRVAVMGGGGPIGLFA
VQWAKIMGAAEVVAVDVSDEKKKLALEAGADAAVSTGPELDELTGTGFNCVVETSGVPAV
EDIAVGITARHGSAVFIGIPNAPVTISKANWDRMMRLEIDVQGSWNSFSAPFPGAEWTTT
LHHMAAGNLKWEFMITHEEPVEKVPELIKAMAERTVFSSKVLFLPNGTL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgactgagacgatgacagcggccgtgatgcacgcggtgggagacatccgcatcgaggag
gtccccaagccggtggccggccccggtgaggcgcttctcaaggtggccgcctgcggcgtc
tgcgggtcggacctggcccgcatgttcctcaagggcccgcacaagctgccgctcatctgc
ggccacgagttctccgcctgggtggaggaggtcggtgagggggtgacgtcggtgaagccc
ggcgatctggtcaccgtgccaccgatgctgccctgcttcaagtgcccgccctgcgtccag
ggggagttcagcctctgcgaggactacgactactacggttcccgtcgcgatggcgcctac
gccgagtatgtcgcagggccggccgacctgctgctgaaggcgcccgagggcctggatccg
cgggccgccgcgatggtggacccctccgccatcgccctgcacgccatctggcgcacgaag
ctgcgcgccggccagcgggtcgccgtgatgggcggcggcggaccgatcggcctgttcgcc
gtccagtgggcgaagatcatgggggccgccgaggtggtggccgtcgacgtctccgacgag
aagaagaagctggccctggaggccggggccgacgccgccgtcagcaccggtcccgagctc
gacgagctcaccggaaccggcttcaactgcgtcgtggagacctcgggcgtgcccgccgtc
gaggacatcgcggtcggcatcaccgccaggcacggctcggccgtgttcatcggcattccg
aacgccccggtcaccatctccaaggcgaactgggaccgcatgatgcgtctggagatcgac
gtccagggctcctggaactccttctccgcgcccttcccgggagccgagtggacgaccacc
ctgcatcacatggccgccgggaacctcaagtgggagttcatgatcacccacgaggagccc
gtcgagaaggtgcccgagctcatcaaggcgatggccgagcgcaccgtcttctcctccaag
gtgctgttcctcccgaacgggacgctgtga

DBGET integrated database retrieval system