KEGG   Acidipropionibacterium acidipropionici CGMCC 1.2230: ASQ49_07855Help
Entry
ASQ49_07855       CDS       T04523                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
aaci  Acidipropionibacterium acidipropionici CGMCC 1.2230
Pathway
aaci00790  Folate biosynthesis
aaci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaci00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ASQ49_07855
Enzymes [BR:aaci01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ASQ49_07855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Aldolase DUF935
Motif
Other DBs
NCBI-ProteinID: ALN15197
UniProt: A0A1P8TY40
LinkDB All DBs
Position
1787638..1788504
Genome map
AA seq 288 aa AA seqDB search
MIDVDPAACAPHPPRTLVMGVVNVTPDSFSDGGMWLERDDAIAHAGQLIAEGADLIDVGG
ESTRPGTARTSSAEELARVVPVVEALAGAGARISVDTMRSEVALAAIEAGAKIINDVSGG
LADPRMLPVVAEHGVDYVVMHWRAQSATMQDPSLTHYDDVTAEVIAEVSTRVQAAQDAGI
ARERIIVDPGVGFSKNGPQNWQLLREIDRFQEGFADLRVLWGVSRKGFLGTLLAAGSPVR
GPRPPMGRDAATQALTAWCAGHGAWAVRTHEVQGNRDTCEVFGRLAAE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgattgacgtcgaccccgcagcctgcgcaccgcatccgccacggactctcgtgatgggt
gtggtcaacgtcacccccgactccttctccgacggcgggatgtggctggagcgcgacgac
gccatcgcccatgccggccagctcatcgccgagggggccgatctcatcgacgtcggcggg
gagtcgacccggcccggaaccgccaggacgtcgtcggccgaggagctggccagggtggtg
ccggtggtcgaggcgctggccggggcaggggcgcgcatctcggtggacacgatgcgctcc
gaggtggccctggcggccatcgaggcgggggccaagatcatcaacgacgtctccggggga
ctcgccgatccgcggatgcttccggtcgtcgccgagcacggcgtcgactatgtcgtgatg
cactggcgggcgcagtcggcgaccatgcaggatccgtcgctcacccactacgacgacgtg
accgcggaggtgatcgccgaggtgtcgacccgggtgcaggcggcccaggacgccgggatc
gcgagggagaggatcatcgtggacccgggggtcgggttctccaagaacggcccccagaac
tggcagctgctgcgcgagatcgatcgcttccaggaagggttcgccgacctgcgggtgctg
tggggggtctcgcgcaaggggttcctgggcacgctgctggccgccggatccccggtgagg
gggccgcgcccgccgatggggcgcgacgccgccacccaggcgctgacggcatggtgcgcc
gggcacggggcgtgggcggtgcgcacccacgaggtgcaggggaaccgggacacctgcgag
gtcttcggccgactggccgccgagtga

DBGET integrated database retrieval system