KEGG   Acidipropionibacterium acidipropionici CGMCC 1.2230: ASQ49_08410Help
Entry
ASQ49_08410       CDS       T04523                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aaci  Acidipropionibacterium acidipropionici CGMCC 1.2230
Brite
KEGG Orthology (KO) [BR:aaci00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ASQ49_08410
Enzymes [BR:aaci01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ASQ49_08410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA FAD_oxidored Thioredoxin_3 HI0933_like DAO Thi4 NAD_binding_8 FAD_binding_3 Glutaredoxin K_oxygenase AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ALN15285
UniProt: A0A142KGH0
LinkDB All DBs
Position
complement(1909067..1910659)
Genome map
AA seq 530 aa AA seqDB search
MLDSALTHQLADYLEMTTEPVALVPSPGEGRKSSQMMELLGEIAALSDDVTVTEPVADPR
TPSFAITRPGTGISVRFAGLPMGHEFTSLVLALLQVGGVPVKEDPALIDAVRSVKGHHEF
TTYMSLTCQNCPTVVQALNAMSIINPNIRHTAVEGGTFKAEVDDLGIQSVPAIHLDGREW
GSGRMTMADILEKLDSSAAGQAAEDLSGRDPYDVLVVGGGPAGAAAAVYAARKGIRTAMV
GDRIGGQVLDTDAIENLISVPHTTGPRLAAALGAHVAEYGVDTIERQRAEELIPAGPDGL
TAVRFTGGQLRARSVILATGARWRHLGVPGEDEYRTRGVTYCPHCDGPLFAGKDVAVVGG
GNSGIEAAIDLAGVARHVTVVEFLDDLKADAVLLEALGKLPNASVIASARTTRVIGDGAH
VTGLEYEDRTTGRTGSLDVEGIFVQIGLLPNTEWLGDAVKLTRRGEIVVDARKATSVPGV
YAAGDCTTQPYKQIIISMGAGAMASLAAFDHLIRSAGAAGTIPTPLAQAS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
ttgcttgactccgccctcacccaccagctcgccgactacctggagatgaccaccgagccg
gtggctctggtcccctcccccggggaggggaggaagtccagccagatgatggaactgctc
ggcgagatcgctgctctcagcgacgacgtcaccgtcaccgaacccgtcgccgacccccgc
accccgtccttcgccatcacccggcccggaaccggcatctccgtgcgcttcgccggactg
ccgatgggccacgagttcacctccctggtgctggccctgctccaggtcggaggggtcccg
gtcaaggaggatcccgccctgatcgacgccgtgcgaagcgtcaaggggcatcacgagttc
accacctacatgtcgctcacctgccagaactgccccaccgtcgtgcaggccctcaacgcc
atgagcatcatcaaccccaacatccgccacaccgccgtggagggcggcaccttcaaggcc
gaggtcgacgacctcggcatccagtcggtgcccgccatccacctcgacggccgggagtgg
ggatcgggccggatgacgatggccgacatcctggagaagctcgactcctcggccgccggg
caggccgccgaggacctgtccgggcgcgacccctacgacgtcctggtcgtgggtggtggc
ccggccggtgcagcggccgccgtctacgccgcccgcaagggcatccgcaccgccatggtg
ggcgaccggatcggcgggcaggtgctcgacaccgacgccatcgagaacctcatctcggtc
ccccacaccaccgggccccggctggccgcggcgctcggcgcccacgtcgccgagtacggc
gtcgacaccatcgagcgccagcgagccgaggagctcatccccgcaggcccggacggcctg
accgccgtacggttcaccggcgggcagctgcgcgcgaggtcggtcatcctggccaccgga
gcccgctggcgccatctgggggtccccggcgaggacgagtaccgcaccaggggcgtcacc
tactgcccccactgcgacggccccctgttcgccggcaaggacgtcgccgtggtcggaggc
ggcaactcgggcatcgaggccgccatcgacctggcaggggtcgcgcgtcacgtgaccgtc
gtcgaattcctggacgacctcaaggccgacgccgtcctgctggaagcactcggcaagctg
cccaacgccagcgtcatcgcctcggcccggaccacccgggtgatcggcgacggggcccat
gtcaccggcctcgagtacgaggaccgcaccaccggccggaccggcagcctggatgtcgag
ggaatcttcgtccagatcggcctgctgcccaacaccgaatggctcggcgatgcggtcaag
ctcacccgccgcggtgagatcgtggtggacgcccgcaaggccacctcggtgcccggcgtc
tacgccgccggggactgcaccacccagccgtacaagcagatcatcatctcgatgggggca
ggggcgatggcctcgctggccgccttcgaccatctgatccgctcggccggtgccgcgggc
accatcccgactccgctcgcccaggcgtcctga

DBGET integrated database retrieval system