KEGG   Acidipropionibacterium acidipropionici CGMCC 1.2230: ASQ49_12020Help
Entry
ASQ49_12020       CDS       T04523                                 

Gene name
kgd
Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
aaci  Acidipropionibacterium acidipropionici CGMCC 1.2230
Pathway
aaci00020  Citrate cycle (TCA cycle)
aaci00310  Lysine degradation
aaci00380  Tryptophan metabolism
aaci01100  Metabolic pathways
aaci01110  Biosynthesis of secondary metabolites
aaci01120  Microbial metabolism in diverse environments
aaci01130  Biosynthesis of antibiotics
aaci01200  Carbon metabolism
Module
aaci_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aaci_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aaci00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ASQ49_12020 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    ASQ49_12020 (kgd)
   00380 Tryptophan metabolism
    ASQ49_12020 (kgd)
Enzymes [BR:aaci01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     ASQ49_12020 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr 2-oxoacid_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ALN15864
UniProt: A0A1P8TWB0
LinkDB All DBs
Position
complement(2676149..2679904)
Genome map
AA seq 1251 aa AA seqDB search
MASSAGHSSSIPADSDFGANDWLIEEMRERFEADPGSVDPAWSTFFLTGPSAPRSPDRPE
EQAQSSPAQPAPSRPAQTPPAAATPPATKPAPARPAEPAPEHRRQAPEHRQPVANEAPKA
APPVPSSEPERVRLRGAPMRTARNMEDSLSMPTATSVREVPMKLVIENRTMINKFLSQSK
GGKVSFTHLLGYAMVQALKDVPEMNNAYAEIDGKPHLVENHSINLGLAIDVVGSDGTRKL
VVPAITSAETLDFAGFWAAYEEIVRKGRTNSLTVEDFRGVTASLTNPGGIGTNHSVPRLM
PGQGVILGMGSIDYPAEWQGGSPSRLAELGISKLTTLTSTYDHRIIQGAQSGEFLRRIHQ
LLLGEDRFYEDIFESLRIPYAPVQWAPDRMANRPDQVSKQVRVITLIEAWRKFGHLSADL
DPLEYKPRYHHDLMLNSHGLTLWDLDRRFPVNNFGGKKRANLTLREILDILRDSYASTLG
IEYMHITDHVQRSWFQERFERAHTPLSREVHLQILDQLNEAEVFETFLQTKYVGQKRFSL
EGGESAIVLLSALCSQAANKGLDEVCIGMPHRGRLNVLANIVGKSYGQIFREFEGNAAPS
NAQGSGDVKYHLGDEGLFTSPSGTTIKASVAANPSHLEAVDPVLEGICRAKLDVLGNPED
YPVLPILMHGDAAFAGQGVVFETLQMSQLEGYSTGGTVHIVVNNQIGYTTSPSDGRTSTY
ATGVAKSIAAPVIHVNGDEPASVVRAARIAFEYRQTFHRDVVIDLVCYRRRGHNEGDDPS
FTQPHMYDLISQKRSTRTIYTENLIGRGDISVEDAEAVMSKFRDRLETVFKEVRQATSAP
APYDSAPDYPAKRNVDRPTAVSAELMEQVATAQEHLPASFTPHPKIAPQLARRAKGLREG
GVDWASAEMLALGSLLTEGLHVRMVGQDTRRGTFSQRFGAIVDRVTSRRYIPVNHILDGQ
VGHLDIYDSPLNEFASLGFEYGYSVARPDSLVLWEAQFGDFVNGAQTIIDEFIASAGAKW
GQKSGVVLLLPHGYEGQGPDHSSARLERFLSLCSDEAMAVCQPSSPASYFHLLRYHAYVN
LHRPVVIATPKSMLRNKMAVSAVDEFTRGHWEQVLPDPSITDPSRVRQVILCSGKVRWEL
IRRRAQQGLDAEVAIVSMERLYPMPVASLTRALSPFAHVRDVRWVQEEPKNQGPWPYIQT
HLAEETADALPWLGAGLSVVSRPSLAASSVGQHRAHMAEEEALLTAAFAQR
NT seq 3756 nt NT seq  +upstreamnt  +downstreamnt
gtggcatcctccgccggacacagcagttccatccccgcagacagcgacttcggagccaat
gactggctgatcgaggagatgcgggagcgattcgaggccgatccgggatccgtggatccg
gcctggtccaccttcttcctgaccgggccttcggccccccggtcaccagaccggcccgag
gagcaggctcagtcctcacccgcacaaccggccccctcgcgaccggctcagactcccccg
gcggctgcgacgccaccggccaccaagcccgctcccgcccgaccggcggaacccgccccc
gagcaccgccggcaggcccccgaacaccgccaaccggtggccaatgaggctcccaaggcg
gccccgcccgtgccctcgagcgaaccggagagagtccggctgcgcggcgccccgatgcgc
accgcccggaacatggaggactcgctgtcgatgccgacggccacctcggtgcgcgaggtc
ccgatgaagctcgtcatcgagaaccgcacgatgatcaacaaattcctcagccagagcaag
ggcggcaaggtctccttcacccacctcctgggctacgccatggtgcaggccctcaaggac
gtgccggagatgaacaacgcctacgccgagatcgacgggaagccccacctggtcgagaac
cactcgatcaacctgggcctggcgatcgacgtcgtgggatccgacggcacccgcaagctc
gtcgtgccggcgatcacctcggccgagaccctggacttcgccgggttctgggccgcatac
gaggagatcgtccgcaaggggcgcaccaactcgctgaccgtcgaggacttccgcggggtc
accgcctccctcaccaatccgggcgggatcggcaccaaccactcggtgccgaggctgatg
cccggtcagggcgtcatcctgggcatggggtcgatcgactacccggccgagtggcagggc
ggcagcccgagccgactggcggagctgggcatctccaagctcaccaccctcacctccacc
tacgaccaccgcatcatccagggagcccagtccggggagttcctcagacggatccatcag
ctgctgctgggcgaggaccgcttctacgaggacatcttcgagtccctgcgcatcccctac
gcccccgtccagtgggccccggaccggatggccaaccggcccgaccaggtgagcaagcag
gtccgcgtcatcaccctcatcgaggcctggcggaagttcggccacctgtcggccgatctg
gatcccctcgagtacaagccccgctaccatcacgacctcatgctcaacagccacgggctc
accctgtgggatctcgaccggcggttcccggtcaacaacttcggcggcaagaagcgggcc
aatctcacgctgcgcgagatcctcgacatcctgcgcgactcctacgcctccacgctgggc
atcgagtacatgcacatcaccgatcacgtgcagcgcagctggttccaggagcgcttcgag
cgcgcccacaccccgctgtcgcgggaggtccatctgcagatcctcgaccagctcaacgag
gccgaggtcttcgagaccttcctgcagaccaagtacgtcggccagaagaggttcagcctc
gagggaggcgagtcggccatcgtgctgctctcggcactgtgctcccaggccgccaacaag
ggcctggacgaggtctgcatcggcatgccccaccgcggccggctcaacgtgctcgccaac
atcgtcggcaagtcctacggacagatcttccgggagttcgagggcaacgccgcgccgtcg
aacgcccagggctcgggcgacgtcaagtaccatctgggcgacgagggactcttcacgtct
ccctcgggaaccaccatcaaggcctcggtggccgccaatccgagccacctggaggccgtc
gacccggtgctggagggcatctgccgggccaagttggacgtcctgggcaatcccgaggac
taccccgtgctgccgatcctcatgcacggcgacgccgccttcgccggccagggagtggtc
ttcgagacactgcagatgagccagctggagggctactcgaccggcggcaccgtccacatc
gtggtgaacaaccagatcggctacaccacctccccctccgacgggcgcacctccacctac
gccaccggtgtcgcgaagtccatcgccgccccggtgatccacgtcaacggcgatgagccg
gcctccgtggtgcgggcggccaggatcgccttcgagtaccgccagaccttccaccgcgac
gtcgtcatcgacctggtctgctaccggcgacgcggccacaacgagggcgacgacccgagc
ttcacccagccccacatgtacgacctcatctcccagaagaggtcgacgcgcacgatctac
accgagaatctcatcggccgcggggacatcagcgtcgaggacgccgaggcggtaatgtcg
aagttccgcgaccggctggagaccgtcttcaaggaggtgcgtcaggccacctccgcaccg
gccccctacgactcggctcccgactaccccgccaagcgcaacgtcgaccgtcccaccgcc
gtgagcgccgagctcatggagcaggtcgccaccgcccaggagcacctgccggcctccttc
accccccatccgaagatcgccccccagctcgcccggcgtgccaagggcctgcgagagggg
ggcgtcgactgggcctccgccgagatgctggccctgggatccctgctcaccgaggggctg
cacgtgcggatggtcggccaggacacccgccgcggcaccttctcccagcggttcggagcc
atcgtggaccgggtcaccagccggcggtacatcccggtgaaccacatcctcgacggccag
gtgggccacctcgatatctacgactcccccctcaacgagttcgcgtcgctgggattcgag
tacgggtactcggtggccaggccggactccctggtgctctgggaggcccagttcggcgac
ttcgtcaacggcgcgcagaccatcatcgacgagttcatcgcctcggccggcgccaagtgg
ggccagaagtccggggtcgtcctgctgctgccccacggctacgagggtcagggcccggat
cactcctcggcccgcctcgagcgcttcctgtcgctgtgcagcgacgaggcgatggcggtc
tgtcagccctccagcccggccagctacttccacctgctgcgctaccacgcctacgtcaac
ctgcaccggcccgtggtgatcgctacccccaagtcgatgctgcgcaacaagatggcggtc
tcggcagtcgacgagttcacccggggccactgggagcaggtgctgcccgacccctccatc
accgacccgtcacgggtgcgccaggtgatcctgtgctcggggaaggtgcgctgggagctc
atccggcgccgggcccagcagggcctggacgccgaggtggccatcgtgagcatggagagg
ctgtacccgatgccggtggcgtcgctgacccgggcgctgagccccttcgcccacgtccgc
gatgtccgctgggtgcaggaggagccgaagaaccaggggccgtggccctacatccagact
cacctcgccgaggagaccgccgacgcgctgccgtggctgggagccggtctcagcgtcgtg
tccaggccctccctggccgcctcctcggtcggccagcacagggcccacatggccgaggag
gaggcccttctcaccgccgccttcgcgcagcgatga

DBGET integrated database retrieval system