KEGG   Aggregatibacter actinomycetemcomitans NUM4039: AANUM_0349Help
Entry
AANUM_0349        CDS       T04531                                 

Definition
(GenBank) DacC protein
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
aacn  Aggregatibacter actinomycetemcomitans NUM4039
Pathway
aacn00550  Peptidoglycan biosynthesis
aacn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aacn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AANUM_0349
Enzymes [BR:aacn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AANUM_0349
Peptidases and inhibitors [BR:aacn01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AANUM_0349
Peptidoglycan biosynthesis and degradation proteins [BR:aacn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AANUM_0349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 tRNA-synt_1_2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: BAS47580
LinkDB All DBs
Position
339116..340306
Genome map
AA seq 396 aa AA seqDB search
MFNKAVKNSKIAIVSGVLAVSLGAMAAEDVQFNIAVPEINAQTYVLMDYNSGAVLASLNP
DQRQYPASLTKMMTSYVVGQAIKQGKIRNTDMVTIGESSWGHKFPGSSKMFLNLNQQVSV
ADLHRGIIIVSGNDACVAMAEHVSGTVMNFVDTMNKYVEQFGLKNTYFTTVHGLDEDNQY
SSARDMAIIGARIIRDLPEEYKIYAEKDFTFNKIKQPNRNGLLWDKTINVDGMKTGHTDK
AGYNLVASAISPNNMRLISVVMGVPTYKGREVESKKLLQWGFANFETFKTLDSGKSISEQ
RVYYGDESNIQLGVLQDAFITIPKGKSAELKARYELEKKYLEAPLAKGQVVGKVVYQLDG
KDIASVNLQVMQEVKEGGIFGKIWDWLVLTIKSLFD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtttaataaagcagtaaaaaacagcaagattgccatcgtctcaggggtattggcggta
tcgctcggtgctatggcggcggaagacgtacaatttaacatcgccgtgccggaaattaat
gcacaaacctacgtcttaatggattacaactccggtgccgtgttggcgtcccttaaccct
gatcagcgccaatatccggcatcattgaccaaaatgatgaccagctatgtggtcgggcag
gcgattaagcaaggtaaaatccgtaatacggatatggtcaccatcggcgaaagctcctgg
gggcataaattccccggttcttccaaaatgttcttaaacttaaatcaacaggtttccgtt
gcggatttacatcgcggcatcatcattgtttcgggtaatgacgcctgcgtggcaatggcg
gagcatgtttccggcacggtgatgaacttcgttgataccatgaataaatatgtggaacag
ttcggtttaaaaaatacctatttcaccacggtgcacggtttagatgaagataaccaatac
tcttccgcccgcgatatggcgattatcggcgcgcgtattattcgtgatttaccggaagaa
tataaaatttacgccgaaaaagattttacctttaacaaaatcaaacagcctaatcgcaac
ggcttgttatgggacaaaaccattaacgttgacggtatgaaaaccggtcacacggataaa
gcggggtacaacctggtggcttccgccatcagcccgaacaatatgcgtttgatttctgtg
gtgatgggcgtgccgacttataaaggtcgcgaagtggaaagcaaaaaattattgcaatgg
ggttttgctaattttgagaccttcaaaaccttggattcaggcaaatccatttccgaacaa
cgggtgtattacggcgatgaaagtaacatccaattaggcgtgttacaagatgctttcatc
accattccgaaaggcaaaagcgccgagctcaaagcccgttacgaattagagaaaaaatac
cttgaagcgccccttgccaaagggcaagttgtgggcaaggtggtgtatcaattagacggc
aaagacatcgccagtgtaaacttacaagtgatgcaagaagtgaaagaaggcggtatcttc
ggcaaaatctgggactggctggtgctgaccatcaaaagtttatttgactag

DBGET integrated database retrieval system