KEGG   Aggregatibacter actinomycetemcomitans NUM4039: AANUM_1585
Entry
AANUM_1585        CDS       T04531                                 

Definition
(GenBank) galactitol-1-phosphate dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
aacn  Aggregatibacter actinomycetemcomitans NUM4039
Pathway
aacn00052  Galactose metabolism
aacn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aacn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AANUM_1585
Enzymes [BR:aacn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     AANUM_1585
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C 2-Hacid_dh_C Pyr_redox_2
Other DBs
NCBI-ProteinID: BAS48816
LinkDB
Position
1564584..1565564
AA seq 326 aa
MKAVVVEENRKLVLADIAMPKIEDGEDVLVKVLYSGVCGSDIPRIFHHGTHFYPIVLGHE
FCGTVTDIGKDATEFRKGELVVCAPLQPCFDCEGCHKGYYSLCKNYNFIGSRRFGANAEY
ICVNKKNLVKVSPDSNPLHDAFIEPITVGLHAINLAQGCADKNVIVVGAGTIGLLAAQCA
EALGATQTFNSRELAAEEIEKRLLDSRFDQLVLETAGVPQSVELAIKIAGPRAQVALIGT
LHNDLTLNQKVFGFILRKELSIPGSWMNYSAPWPGGEWTKAIELVKQGKIQFDKLIASVN
FIEDYITEVEKLDGTPMNGKIVLKFQ
NT seq 981 nt   +upstreamnt  +downstreamnt
atgaaagcggttgttgttgaagaaaacagaaaattggtgctggcggacattgcgatgccg
aaaatcgaagatggggaagacgtgctggtaaaagtactgtattcgggggtatgcggttcc
gatattccgcgcatatttcaccatggcacgcatttttaccctatcgtattagggcatgaa
ttttgcggtacggtgacggatataggaaaagacgcgacggaattccgcaaaggggagctg
gtagtttgcgcgccgttgcaaccttgtttcgactgcgagggatgtcacaaaggatattat
tcgttatgtaaaaactacaatttcatcggttcccgtcgcttcggcgccaatgcggaatat
atttgcgtcaacaagaaaaatttggtgaaagtatcaccggattccaatcccttgcatgat
gcttttatcgaacctattacggtgggtctgcacgccattaatctggcgcagggttgtgcc
gataaaaatgtgattgtggtaggagccggtactattggcttgcttgccgcccagtgtgcc
gaagcgctgggtgctacgcaaaccttcaattcccgtgaattagccgcagaagaaattgaa
aaaagattacttgacagccgttttgaccaactcgtattggaaaccgccggcgttccgcaa
tcagttgaattagcaataaaaattgcaggtccgcgtgcgcaagtggcattgatcggcacc
ctacataatgatttaaccctgaatcagaaagtgttcggttttattttgcgcaaagaattg
agcattcccggttcttggatgaattattccgcgccgtggccgggtggtgaatggacgaag
gcaatcgaattggttaaacaaggtaaaattcaattcgacaaactgattgcgtcggtaaat
ttcattgaagattatattaccgaagttgaaaagcttgatggcacaccgatgaatggaaaa
atagtcttaaaatttcagtaa

DBGET integrated database retrieval system