KEGG   Aggregatibacter actinomycetemcomitans NUM4039: AANUM_1837Help
Entry
AANUM_1837        CDS       T04531                                 

Definition
(GenBank) inner membrane protein YfcA
  KO
K07090  uncharacterized protein
Organism
aacn  Aggregatibacter actinomycetemcomitans NUM4039
Brite
KEGG Orthology (KO) [BR:aacn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    AANUM_1837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE DUF5504
Motif
Other DBs
NCBI-ProteinID: BAS49068
LinkDB All DBs
Position
complement(1826523..1827290)
Genome map
AA seq 255 aa AA seqDB search
MEFGIDILAILFAVAFIAGFIDAIAGGGGLITIPALLMTGLPPAVALGTNKLQACGGSFS
ASLYFLRQRAVKFSEVWLILLMIFLGSIAGTILIQLIDASLIKKILPFLILVIGIYFLVT
PKLGDEDRKQRLSYPVFAFCIGTFMGFYDGFFGPGTGSIMSLACVTLLGFNLAKATAHAK
VMNFTSNLASLIFFLIGGQILWTVGLIMLAGQFIGANLGAKMVMTKGKTLIRPMVVVMSF
IMTVKMAFDQGWFDF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggaattcggaattgatattttagccattttatttgctgttgcctttattgccggtttt
attgacgccattgccggtggcggcggtttaattaccatccccgcgttactgatgacaggg
cttccgccggcggttgcgctcggtaccaataaactacaagcctgtggcggttccttttct
gccagcctttattttctgcgtcaaagagcggttaaattttcggaagtttggttgattttg
ttgatgatcttcctcggatctatcgccggcaccatcttaattcaattaattgatgcttct
ttgatcaagaaaattcttccgtttttgattttggttatcggtatctattttttggtcacc
cctaaactcggagacgaagatcgcaaacagcgtctttcttacccggtttttgcattttgt
atcggtacgtttatgggcttttatgacggctttttcggccccggtaccggttccatcatg
agcttggcttgcgtgacattacttggctttaatctggcaaaagccactgcccatgccaaa
gtgatgaattttacctctaatctggcttccttgattttcttcttaatcggcggacaaatt
ttatggacagtgggcttgattatgctggcagggcagttcatcggcgccaacttaggcgcc
aaaatggtgatgaccaaaggaaaaacgttgattcgccctatggtggtcgtaatgtccttt
atcatgacggtgaaaatggcgtttgatcaaggctggtttgacttttaa

DBGET integrated database retrieval system