KEGG   Aggregatibacter actinomycetemcomitans 624: ACT75_01855Help
Entry
ACT75_01855       CDS       T04753                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aact  Aggregatibacter actinomycetemcomitans 624
Pathway
aact00564  Glycerophospholipid metabolism
aact01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aact00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ACT75_01855
Enzymes [BR:aact01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ACT75_01855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 HI0933_like GIDA Pyr_redox_2 NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AMQ93348
UniProt: A0A142FY68
LinkDB All DBs
Position
complement(409704..411293)
Genome map
AA seq 529 aa AA seqDB search
MQRNIELEKVTSTDKWDFIVIGGGASGLGIALDAASRGYKTLLLEGYDFAKGTSSRSTKL
VHGGVRYLAAGNVALVKEALRERGRLAKNASHLFKNQNFIIPNYNFIDSVKYRVGLGLYD
YLSGDLSLGKTIAINKDTTMQRLPTLNGTDLKNGVVYKDGQFDDSRLAINIAQTVVEQGG
TVLNYAKVTELLKDGQGKINGVKFTDELNGEQYSVHGTAVINATGVFMNEVLSMDHGTDK
KFVVPSQGVHLVLDKSFLPSDDALMIPKTSDGRVLFAVPWHERLVVGTTDTLVKEPSYEP
VALEQEIQFILDTAGQYLTKKPTRDDVLSIFAGLRPLAAPEKVGQSTKEVSRSHKVVVSD
SGLVTITGGKWTTYRQMSEDTVDEALKVHPQLAKKACVTTKLAIHGKIPAEQVDLKNHLY
IYGADIPAIKALEAENPAMTEKIHPRHPNTIAEVVWAARQEMAQSVEDVLARRVRLLFLD
VRAAMDSAAKVANILAKELGKDAQWEKEQTEKFLNIAKHYLLVDYMPQV
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaaatattgaacttgagaaagtaacgagtacggataaatgggattttattgtc
atcggtggtggcgccagcggtttagggattgctttagatgccgcatctcgtggctataaa
accttgttgttggaaggttatgactttgcaaaagggacttcaagccgtagtaccaaatta
gttcacggcggcgtgcgttatttggcggccggcaatgtggcgttagtgaaagaggcgttg
cgtgaacgtggtcgtttagcaaaaaacgcgtcccacctgttcaaaaatcagaattttatt
attcctaactataattttatcgacagcgtgaaataccgtgtcgggttggggttgtatgat
tatttgtccggcgatttaagtttgggtaaaaccatcgcgattaataaagacaccacgatg
cagcgtttaccaaccttaaacggaacggacttgaaaaacggcgtggtatataaagacggt
cagtttgacgattcccgcttggcgataaatatcgcgcaaaccgtggttgaacaaggcggt
accgtgcttaattatgcgaaagtgactgagttgttaaaggacgggcaaggtaaaatcaac
ggcgttaaatttaccgatgaattaaacggcgaacaatatagcgtgcatggtacggcagtg
attaacgctaccggtgtattcatgaatgaggtgttatccatggatcacggtaccgataaa
aaattcgtggtgccaagccaaggggtgcatttggtgttggataaatccttcttaccgagc
gatgacgcgttaatgattccgaaaacttccgacggtcgtgttttattcgcggtgccatgg
catgaaagattggtagtaggaacaacggatacgctggtgaaagaaccgtcttacgaaccc
gttgcgttggaacaggaaattcaatttattttggatacggcaggtcaatacctcaccaag
aaaccgacccgtgatgatgtgttgagtatttttgccggtttacgtccgttagcggcgccg
gaaaaagtcggtcaaagcacgaaagaagtgtcccgtagccacaaagttgtggtcagcgat
agcggtttggttactattaccggcggtaaatggacgacctatcgtcaaatgtcggaagat
acggtggatgaagctttgaaagtgcatccgcaattagcgaaaaaagcctgtgtcaccacg
aagttagcgattcacggtaaaattccggcggaacaggtagatttgaaaaatcacttatac
atttacggtgccgacatcccggcaattaaagccttggaagcggaaaatccggcaatgaca
gagaaaattcatccgcgtcatccgaataccattgccgaagtggtttgggcggcacgtcag
gaaatggcgcaatctgtggaagatgtccttgcccgccgcgtgcgtttgttgttccttgat
gtccgtgcggcgatggacagtgctgcgaaagtggcaaatattctggcgaaagaattaggc
aaagatgcgcaatgggaaaaagaacaaacagaaaaattcttaaacattgcgaaacactat
ttgcttgtggattatatgccgcaagtctag

DBGET integrated database retrieval system