KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0073Help
Entry
TC41_0073         CDS       T01821                                 

Gene name
glpA
Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00564  Glycerophospholipid metabolism
aad01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    TC41_0073 (glpA)
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     TC41_0073 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AEJ42052
UniProt: F8II93
LinkDB All DBs
Position
76576..78270
Genome map
AA seq 564 aa AA seqDB search
MAEARFSTMARSVIKAEMAGEPFDLLIIGGGITGAGILLDATARGMKAALVEMQDFAAGT
SNRSTKLVHGGLRYLKQFEIGLVAEVGKERAIVYENGPHITTPVWMLLPIIEGGTYGWLA
TSVGIYVYDKLAGVKRSERRKMLTAEQALEIEPLLRRDGLKGAGYYVEYRTDDARLTLEI
LKKAVEMGGIALNYAKATGFLYHEGRVAGAEVEDVLTGETFAVRAKKVVNATGPWVDELR
EKDGSKSGKTLHHTKGVHIVVDGKRFPLRNSVYFDVPDGRMVFAIPRDGKTYIGTTDTDY
HGDLVHPRMTKADRDYLIDCVNFMFPSVKLTAADIESSWAGVRPLIHEEGKDPSEISRKD
EVFVSPSGLLTIAGGKLTGYRKMAEKVVDMVASHLAHEGQRFGPCTTDKIPYSGGDFGGS
DKMPAFVEDRVQRGVKLGLAEEDARRLARRYGTNVDVVFNLLVSGRDRAEAYGLRPDVYA
ELEYGLRHEMVVTPSDFFVRRTGALYFDIDWVKENQDSVIRYMAAACGWSDEETERHARE
LQARVMEATTVEEDIPASGNLVGA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcgcggttttcgacgatggcgagatcggtcatcaaagcggagatggctggc
gagccgtttgatttgctcatcatcggcgggggcatcacgggggcgggcatcctgctcgac
gcgacggcgcggggcatgaaggcggcgctcgtcgaaatgcaagacttcgctgcgggcaca
tccaaccggtcgacgaagctcgtgcacggcggcttgcggtatctgaagcagtttgagata
gggctcgttgccgaggtcgggaaggagcgcgctatcgtctacgagaacggcccgcacatc
acgacccccgtgtggatgctgttgcccatcatcgagggcggcacgtacggctggctggcg
acgagcgtgggcatctacgtctacgacaagctcgcgggcgtcaagcgctccgagcggcgc
aagatgctcaccgccgagcaggcgcttgagatcgagccgctgctccgccgcgatggcctg
aagggcgccggctattatgtcgaataccggacagacgacgcccgcctcacgctcgagatt
ctgaaaaaggcggtagagatgggcggtatcgcgctgaactacgcgaaggccaccggtttt
ctctaccatgagggccgcgtcgcgggtgccgaagtcgaggacgtgctcaccggcgaaacg
ttcgccgtccgagcgaagaaggtcgtcaacgccaccggcccctgggtcgatgagctccgg
gagaaggacgggtcgaagtccggcaaaaccctgcatcacaccaaaggcgtgcacatcgtg
gtggacggcaagcggtttccgctccgaaattccgtgtacttcgacgtgcccgacgggcgc
atggtcttcgccattccacgagacggcaagacctacatcggcactaccgacacggattac
cacggcgatctcgtccatccccgcatgaccaaggcggatcgcgactatctcatcgactgc
gtcaacttcatgttcccaagcgtcaagctgacggcggcggacatcgagagcagttgggcg
ggcgttcggccgctcatccacgaagaaggcaaagatccgtccgagatctcgcgcaaggac
gaggtgttcgtctcgccgtctgggcttctcaccatcgcgggcggcaagctcaccggctac
cgcaagatggcggagaaggtcgttgacatggtggcgagccatctcgcccacgaagggcag
cgcttcggaccgtgcaccacggacaaaatcccttattcgggcggggatttcggcggatca
gacaagatgccggcgtttgtcgaggatcgcgtgcagcgcggcgtgaagctcggcctggcg
gaggaggatgcgcggcgcctcgcccgccgctatggcaccaacgtggatgtcgtcttcaac
ctgctggtgtccgggcgggatcgcgcagaggcgtatgggctcaggcccgatgtgtacgcg
gaattggagtacggcctgcggcacgagatggtggtgacgccgtcggatttcttcgtccgg
cgaacgggcgcgctttacttcgacatcgactgggtgaaggagaatcaggattccgtcatc
cgttacatggctgcggcatgcggctggagcgatgaagagaccgagcggcacgcgcgggaa
cttcaggcgcgcgtcatggaggcaaccacggtggaagaagacattcccgcatcgggcaac
ctcgtgggggcgtga

DBGET integrated database retrieval system