KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0430Help
Entry
TC41_0430         CDS       T01821                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TC41_0430
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     TC41_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh ATP-synt_D
Motif
Other DBs
NCBI-ProteinID: AEJ42396
UniProt: F8IL16
LinkDB All DBs
Position
431757..433247
Genome map
AA seq 496 aa AA seqDB search
MHRFDPCLNFIGGRWCEPKTGQYGDNVNPANGEVLGVWARSGPDDLDDAVLAAREAQAAW
RLVPAPERAKVLRRVADLLRDRKEELARTLTMEMGKVIEEARGEVQEAIDMADYMVGEGR
RLFGQTTPSELPDKFAMSVRAPVGVVGIITPWNFPIAIASWKLLPAIVAGNAVVWKPAEE
TPLLARAFAEVYQEAGLPAGVLNVVFGDGPVVGEAMLSHPGIDVISFTGSTETGRHIASR
AGANLKRVSLEMGGKNAITVLADADLDLAVDAIVWSAYGTSGQRCTAASRVIVEREVEEA
LLARLLPRVQALRVGDGLDPAVQVGPVIHEEALAKIDGYVRLGVDEGARLLTGGRRLTEG
PLARGFYYAPTVFAGVRPDMRIAQEEIFGPVLCVMAVDSFEEAIRVNNGVKYGLSASIFT
RDVNRVFRAMRDLDTGIVYVNAGTTGAEIHLPFGGTKATGNGHRDSGQAALDVFTEWKTV
YVDYSGRLQRAQIDNN
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcatcggtttgacccttgtctaaacttcatcggcggcaggtggtgcgagccgaagacg
gggcagtacggggacaacgtcaaccccgcaaacggcgaggtgctcggggtgtgggcgaga
tcgggcccggacgatctcgacgacgccgtcttggcggcccgcgaggcgcaggccgcgtgg
cgcctcgtgcccgcaccggagcgcgcgaaggtgctgcggcgcgtcgcggatctgttgcgg
gatcgcaaggaggaactcgcgcggacgctgacgatggagatgggcaaggtcatcgaggag
gcgcgcggcgaggtgcaggaggccatcgacatggccgattacatggtgggcgaggggagg
aggctcttcggccagaccacgccttcggaactgccggacaagttcgccatgagcgtgcgc
gcgccggtgggcgtggtggggatcatcacgccgtggaactttcccatcgccatcgcgtcg
tggaaattgctcccagccattgtcgccggcaacgccgtggtgtggaagcccgcggaggag
acgccgcttctcgcgcgggcgtttgccgaagtgtatcaggaggccgggctgcccgcgggc
gtgctgaacgtcgtgttcggcgacggcccggtggtcggcgaagcgatgctcagtcaccct
ggcatcgacgtcatctccttcaccggatccaccgagaccgggcggcacatcgcgagccgc
gcgggcgcgaatctgaagcgcgtgtcgctcgagatgggcggcaaaaacgccatcacggtg
ctcgccgacgcagatctggacctcgccgtggacgccatcgtctggagcgcctacggcacg
agcggccagcggtgcaccgcggcgagccgcgtgattgtggagcgagaggtggaggaagcg
ttgctcgctcgcctgctcccgcgcgtgcaggcgctccgagttggcgacgggctggatccg
gccgtccaggttggccccgtcatccacgaggaagcgctcgcgaagatcgatgggtacgtg
cggctcggtgtcgacgaaggcgcgcggctcttgaccggcggccgcaggctgacggagggg
ccgctggcacgtggcttttactatgcgccgaccgtgttcgcgggcgtccgccccgacatg
cgcatcgcccaggaggagatcttcggcccggtgctctgcgtgatggccgtggactcgttc
gaggaggccattcgcgtcaacaacggcgtgaagtacgggctctcggccagcatcttcacg
cgcgacgtcaaccgcgtgtttcgcgccatgcgcgatctcgacaccggtatcgtctacgtc
aacgcgggcacaaccggcgcggaaattcatctgccctttggcggcactaaggccaccgga
aacggacaccgggattccggccaggccgccctcgacgtcttcacggaatggaagaccgtg
tacgtcgactacagcggtcgactgcagcgcgcgcagatcgacaacaactga

DBGET integrated database retrieval system