KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0723Help
Entry
TC41_0723         CDS       T01821                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00010  Glycolysis / Gluconeogenesis
aad00053  Ascorbate and aldarate metabolism
aad00071  Fatty acid degradation
aad00280  Valine, leucine and isoleucine degradation
aad00310  Lysine degradation
aad00330  Arginine and proline metabolism
aad00340  Histidine metabolism
aad00380  Tryptophan metabolism
aad00410  beta-Alanine metabolism
aad00561  Glycerolipid metabolism
aad00620  Pyruvate metabolism
aad00625  Chloroalkane and chloroalkene degradation
aad00903  Limonene and pinene degradation
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01120  Microbial metabolism in diverse environments
aad01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TC41_0723
   00053 Ascorbate and aldarate metabolism
    TC41_0723
   00620 Pyruvate metabolism
    TC41_0723
  Lipid metabolism
   00071 Fatty acid degradation
    TC41_0723
   00561 Glycerolipid metabolism
    TC41_0723
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TC41_0723
   00310 Lysine degradation
    TC41_0723
   00330 Arginine and proline metabolism
    TC41_0723
   00340 Histidine metabolism
    TC41_0723
   00380 Tryptophan metabolism
    TC41_0723
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TC41_0723
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TC41_0723
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TC41_0723
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     TC41_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEJ42681
UniProt: F8IEG7
LinkDB All DBs
Position
734261..735730
Genome map
AA seq 489 aa AA seqDB search
MEATMLDVRQLSRQYIAGEWRDGRSSRVHLDQNPFDGSTVAEIRLATVEDIDQAYRAASE
AQKTWAQVSPFERQAVMERALQIWEGYRDEVISLVADEIGGTFIKAAIEFELVKNFLREA
ATYPLRMEGRLLPATIPGKENRLLRLPAGVVGILSPFNFPMCLSMRALAPAVACGNGVVL
KPHEEAAITGGTLLAKVFEEAGVPKGLVNVVVADVAEIGDAFLEHPIPRIISFTGSTAVG
RHIAEVAGRHLKRVTLELGGNSALIVLDDADLDLAVDAAIFSRFTHQGQICMCANRLIVV
KDVYEQFLGKFVERVSKLKMGNPRDPETVIGPLINRRQVERLLAVVDTSLEQGARVAYRG
PVEGNVVGPVVLVDVRPEMACAREEMFGPVVAVIPVENEEDAVRVANDSDYGLTGAVITR
DVERGVRIAMQVETGMFHVNDGTVNDEPLVAFGGERASGVGGYNGQWGIEEFTTLKWISI
QRERRQYPI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaggccaccatgctggatgtcaggcaactctcacgacaatacatcgccggtgagtgg
cgcgacggacgcagttctcgcgtgcatctcgatcagaatccgttcgatggctcgacggtc
gccgagattcggcttgccacggtggaagacatcgaccaggcgtatcgcgccgcctcggag
gcgcagaagacctgggctcaggtgagtccgttcgaacggcaggcggtcatggagcgagcg
ctgcagatctgggagggctatcgagatgaggtgatctcgctcgtcgcggacgagatcgga
ggcacgttcatcaaggcggcgattgagttcgaattggtgaagaacttcctccgcgaggcg
gcgacgtacccgctgcgcatggaagggcggctcttgccggccacgattcccggaaaagaa
aatcgcctgttgcgcctgcctgccggggtggtgggcattctgagtccgttcaatttcccg
atgtgtttgtccatgcgcgccttggcgcctgccgtcgcgtgcggcaacggtgtcgtcctg
aagccgcacgaagaggctgccatcacgggcggcacgctgctagcgaaggtgtttgaggag
gcgggcgtaccgaaggggctggtcaacgtcgtcgtggctgacgtcgcggagatcggtgat
gcgtttctcgagcatccgattccgagaatcatctcgttcaccggctccacagcggtcggg
cggcatatcgcggaggtggcgggtcggcacctgaagcgggtgaccctcgaactgggcggc
aacagtgcgcttatcgtgctcgacgatgccgatctcgacctcgccgtcgacgccgcgata
ttcagccggttcacgcatcagggccagatctgcatgtgcgccaatcgcctgatcgtcgtc
aaggatgtgtacgagcaatttctcgggaaatttgtcgaacgcgtctcgaaactgaagatg
ggcaatcctcgggaccccgagacggtcatcgggccgctcatcaaccgccgtcaggtcgag
cggctgctcgccgtcgtcgatacgagccttgaacagggcgctcgagttgcctatcgggga
cccgtggaggggaacgtcgtggggccagtggtgctcgtggatgtgcgcccggagatggcg
tgtgcccgagaggagatgttcggccccgtggtggcggtcatacccgtcgagaacgaggaa
gacgcggtgcgcgtggccaacgacagcgactacggcctgacgggggctgtcatcactcgc
gacgtggaacgcggtgtgcggatcgccatgcaggtggaaacaggtatgtttcacgtgaac
gacggtacggtgaacgacgagcctctcgtggcgtttggcggcgaaagggcttcgggcgtc
ggggggtacaacggacagtgggggatcgaggagtttaccacgctcaaatggatttccatt
cagcgcgaacggcgccagtatcccatttga

DBGET integrated database retrieval system