KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0910Help
Entry
TC41_0910         CDS       T01821                                 

Gene name
metB
Definition
(GenBank) Cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00270  Cysteine and methionine metabolism
aad00450  Selenocompound metabolism
aad00920  Sulfur metabolism
aad01100  Metabolic pathways
aad01110  Biosynthesis of secondary metabolites
aad01130  Biosynthesis of antibiotics
aad01230  Biosynthesis of amino acids
Module
aad_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:aad00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    TC41_0910 (metB)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TC41_0910 (metB)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TC41_0910 (metB)
Enzymes [BR:aad01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     TC41_0910 (metB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 DegT_DnrJ_EryC1 SelA GDC-P Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: AEJ42863
UniProt: F8IFG1
LinkDB All DBs
Position
928389..929555
Genome map
AA seq 388 aa AA seqDB search
MKIESKLAQIGNRQDPRTGAVSAPIYHSTTYAHPALGQSTGFDYTRTLNPTRKVLEDAIA
ELEGGVRGFAFSSGMAAVHAVFSLFSPGDHVIVSSDLYGGTYRVLEHIFRPLGIEATYVH
TGHLEEVEAALRDTTRALFIETPTNPTMQMTDIAAASLFARRRGLLTIVDNTFMTPYFQR
PIELGADIVVHSATKFLGGHNDVLAGLVVAKSAEIAERLYFVQNSIGAVLGPQDAWLLMR
GMKTLAIRMERCAMNASAIAAWLDARDDIVKVYYPGLDTHPGKSICSKQASGFGGMVSFE
VLDARMVPFILEHLKLVTFAESLGGVETLITYPTRQTHADIPEEIREKVGVTDRLLRLSV
GIEHIGDLIDDLSQALDYAAEQVLSRRR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatcgaatcaaagctggcccaaattgggaatcgccaggatcccaggacgggagcc
gtgtctgccccaatttatcactcgacgacatacgctcatccggcgctcggccaaagcacc
ggattcgattacacgcggacgctcaatccgactcgcaaagtcctcgaggacgccatcgcc
gagttggagggtggcgtgcgcggattcgccttctcctccggcatggccgcagtccacgcc
gtcttttcgctgttctccccgggcgatcacgtcatcgtctcgagcgatctgtacggcggc
acctatcgcgtgcttgagcacatctttcgcccgctcggcatcgaggccacgtatgtgcac
acgggccacctcgaggaggtggaggccgccctgcgcgataccacgcgggcgctcttcatc
gaaacgcccaccaatccgaccatgcaaatgacggacatcgcggccgcgagcctgtttgcg
cgccggcgcggtcttttgaccatcgtggacaacacgttcatgacgccctatttccagcgt
cccattgagctgggcgcggatatcgtggttcactcggccacgaagtttctgggcggacac
aacgacgtgctcgccggcctcgtcgtggcgaaatcggccgagatcgccgagcggctgtac
ttcgtccagaactccatcggcgccgtgctcgggccgcaggacgcgtggctgctcatgcgc
ggcatgaagacgctcgccatccgcatggagcggtgcgccatgaacgcgagcgccattgcg
gcatggctcgacgcgcgcgacgacatcgtgaaggtctactatcccggcctcgatacgcac
ccggggaagtccatctgctcgaagcaggcgtccggcttcgggggcatggtgtcgttcgag
gtgctggacgcgcggatggtgccgttcatcctcgagcatttgaagctcgtcacattcgcg
gagagtctgggtggcgtcgagacgctcatcacgtatcccactcggcagactcatgccgac
attccggaggaaattcgggagaaggtgggcgtcaccgacaggctgctgcggctgtcggtg
ggcatcgagcacatcggggatctcattgacgatctcagccaggcgctggattacgctgcg
gagcaagtgctctcccgcaggcgatga

DBGET integrated database retrieval system