KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0927Help
Entry
TC41_0927         CDS       T01821                                 

Gene name
tagO
Definition
(GenBank) Glycosyl transferase, family 4, conserved region
  KO
K02851  UDP-GlcNAc:undecaprenyl-phosphate/decaprenyl-phosphate GlcNAc-1-phosphate transferase [EC:2.7.8.33 2.7.8.35]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aad01003]
    TC41_0927 (tagO)
   01005 Lipopolysaccharide biosynthesis proteins [BR:aad01005]
    TC41_0927 (tagO)
Enzymes [BR:aad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.33  UDP-N-acetylglucosamine---undecaprenyl-phosphate N-acetylglucosaminephosphotransferase
     TC41_0927 (tagO)
    2.7.8.35  UDP-N-acetylglucosamine---decaprenyl-phosphate N-acetylglucosaminephosphotransferase
     TC41_0927 (tagO)
Glycosyltransferases [BR:aad01003]
 Polysaccharide
  Bacterial polysaccharide
   TC41_0927 (tagO)
Lipopolysaccharide biosynthesis proteins [BR:aad01005]
 O-antigen
  TC41_0927 (tagO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4
Motif
Other DBs
NCBI-ProteinID: AEJ42880
UniProt: F8IFH8
LinkDB All DBs
Position
complement(950092..950967)
Genome map
AA seq 291 aa AA seqDB search
MDLPNERKIHRDPLPLLGGAAIFAGVIGAFLAGSLWKDWFDTPYIGVVIGAAMLFVIGLL
DDYYKTRGKDFSVGIRFVVQILAALMVPLFGGAIQGFTSPFGGHHFVAIPPYLSLFLTLL
WIVGVTNVFNFLDGVDGLAAGIAAISATTLFFVALIKGDTASAWFAIAVTGAAVGFLRHN
FYPARIIMGDAGSTVLGYLLASIASVGAFKSATVVSIGVPILALGVPIFDAVRVVFLRAR
AGRPVYKPDQNHVHHWLLRLGLTQVQTVTVVYLISACFSLMSMLVLLLNRG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtggatcttcccaacgagcgaaaaattcaccgggatccgcttccgctgctcggaggcgcc
gccatttttgcgggcgtcatcggggcatttctcgcaggttcgctctggaaagactggttt
gatacgccgtacatcggcgtcgtgattggcgcggcgatgctctttgtcatcggcctgctc
gatgattattacaagacgagaggcaaggacttttccgtcggcattcgcttcgtggtgcag
atcctcgcggcgctcatggtgccgctcttcggcggcgccatccagggattcacgtctccc
ttcggcggtcaccactttgtggccattcctccttatctttcgcttttcctcacgctcctg
tggattgtaggcgtcacgaacgtcttcaactttctcgacggcgtcgacggccttgcggcc
ggcatcgcggccatctcggcgaccacgctgttctttgtcgcgctcatcaagggcgacaca
gcctccgcctggtttgcgattgcggtgacgggagccgctgtcggcttcctgcgacacaat
ttctatcccgcgcgcatcatcatgggagacgcgggatccaccgtgcttggttatttgctc
gcctccattgcgtcggtcggcgccttcaagtcagccaccgtcgtttccatcggcgtgccc
atcctcgccctgggcgtgcccatcttcgatgcggtccgcgtggtatttttgcgggctcga
gccggacggccggtgtacaagccggatcagaaccacgtgcaccactggctcttgcgcctc
gggctgacgcaggtgcagacggtgactgtggtgtacctcatcagcgcgtgcttttcgctc
atgtccatgctcgtgctgcttttgaatcgcggataa

DBGET integrated database retrieval system