KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_0990Help
Entry
TC41_0990         CDS       T01821                                 

Gene name
sodA
Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Brite
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TC41_0990 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEJ42943
UniProt: F8IFX2
LinkDB All DBs
Position
complement(1006500..1007255)
Genome map
AA seq 251 aa AA seqDB search
MRSVNWTRDVQAARHEDPQISSSSGIVDRHALQWERIMKIRKEVELRMPHQLPPLPYAYD
ALEPHIDAATMNVHYNGHHAAYVNNLNKALEGHPDLESKTVEQLISNLDAVPEDIRTAVR
NNGGGHANHSLFWPLLSPNGGGEPTGKLADAIRETFGSFESFKEQFTQVATARFGSGWAW
LVLDNGKLALMSTANQDNPLMEGKKPILGLDVWEHAYYLKYQNRRPEYIKAWWNVVNWDQ
ANKNYEAALNG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgcgctccgtaaactggacgcgcgacgtgcaggcggcgcggcacgaagatcctcagatt
tcctcctcatctggaattgtggacagacatgcgctacaatgggagcggatcatgaaaatt
cgtaaggaggttgagctgcgcatgccacatcaactcccaccgcttccttatgcgtatgat
gcgctcgagccgcacatcgacgcggcgaccatgaatgttcactacaatggccaccacgcg
gcgtacgtcaacaacctgaacaaggcgcttgagggccatccggatctcgaatccaagacc
gtggaacaactcatcagcaacctggacgccgttccggaggacatccgcaccgcggttcgc
aacaacggcggcggtcacgccaaccacagcctgttctggccgcttctctcgccaaacggc
ggcggcgagccgaccggcaagctggcggacgctatccgggagacgttcggcagctttgag
tccttcaaggaacagttcacgcaggtcgccacggctcgcttcggaagcggctgggcctgg
ctcgtcctcgacaacggcaaactcgccctgatgagcaccgcgaaccaggacaaccccctc
atggagggcaagaagcccatcctcggcctcgacgtatgggagcacgcgtactacctgaag
taccagaaccgccgtccggaatacatcaaagcctggtggaacgtcgtgaactgggatcag
gccaacaagaattacgaggccgcgctgaacggctga

DBGET integrated database retrieval system