KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_1253Help
Entry
TC41_1253         CDS       T01821                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Brite
KEGG Orthology (KO) [BR:aad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aad01001]
    TC41_1253
Enzymes [BR:aad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     TC41_1253
Protein kinases [BR:aad01001]
 Serine/threonine kinases: Other
  Bacterial family
   TC41_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo Kinase-like RIO1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AEJ43195
UniProt: F8IHB0
LinkDB All DBs
Position
1243466..1245412
Genome map
AA seq 648 aa AA seqDB search
MTARALGGRYRLEQKIGEGGMAEVYRAIDTLLDRTVAVKMLRSQYAVDEEFVRRFRQEAQ
AAARLSHPNIVNVYDVGVEDGQQYIVMEYVDGPTLKDVIVERAPLPVEEVIRISKQICSA
LQHAHELHVVHRDIKPHNILLTKSGQVKVADFGIARAATGHTIAHRQATTVLGSVHYFSP
EQARGGPTDAKSDIYSLGVVMYEMLTGKLPFEGDSPVSVALKHLREPFVEPRQLNKDIPQ
SVENIVLRCLVKEPEGRYPNMAAVMADLDAALERPNVPKFVSPSDMDDKTIVVPAMGDRL
SEALKLRRPKADGERAKGARASKPPMAPWKRASLIAGIVVLSLAALGLGGYAAIVIVTRL
LTVPNVELPSVVGKPVASAVATLEAAGFSRQQIQEKFEPNLKAASGIVYQQSPAGNTQVK
KTRDITLYVSQGAPKVAVPDVTNEPLDQAKQALVSAGFSANNIVVQTETSTSVPSGDVIS
SNPAPGTQVPITSKITLTVSQQQYVTVPKLVGLTLQQAEAAIQAAGLTLGTVTPSDLVNQ
NPLVSYAYPYIQGDRVPVGSTINLYVVPNPASIPPSNGTGNDTGNAANGGSQNDLGNAAG
VGNGSTNSAAGDSSAGDTGNATQPTAQSAPQPQPPGKAAPGHLKHKGH
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgcgcgcgctcgggggtcgttaccgtctcgagcagaaaatcggcgaaggcggc
atggcggaagtgtatcgcgccatcgatacgctcctcgatcgcacggtggccgtgaagatg
ctgcgcagccaatacgcggtggacgaggagttcgttcgccgttttcgtcaggaggcgcag
gctgctgcgcgcctttcccatccgaacatcgtcaatgtgtacgatgtgggcgtagaggac
ggccagcaatacatcgtgatggagtacgtcgacggtcccacgttgaaggacgtgatcgtc
gagcgcgcaccgctcccggtcgaggaagtgatccgcatcagcaagcagatctgctcggcc
ttgcagcatgcgcacgagctgcacgtggttcaccgcgacatcaagccgcacaacattctc
ctgacgaagagcggccaggtcaaggtggcggacttcggcatcgcccgggccgcgaccgga
cataccattgcgcatcgccaggcgacgacggtgttgggatcggttcactacttttcgccc
gaacaggcgagagggggtcccacagacgcgaaaagtgacatctattcccttggggtcgtc
atgtacgagatgctgacgggtaaactcccctttgagggagactcccccgtgagcgtcgcg
ctcaagcacctcagggagccgttcgttgaaccgcgccagctgaacaaagacattccgcag
agcgtggagaacatcgttttgcgctgtctcgtcaaggagccggaaggccgttaccccaac
atggccgcggtgatggccgatctcgacgctgcgctcgagcgccccaatgtcccgaagttc
gtctcacctagcgatatggacgacaagaccatcgtggtgcctgcgatgggggatcgcctg
agcgaggctctgaaactgcggaggcccaaggcggacggggagagggccaagggagcgcgc
gcgtccaaaccgccgatggcaccctggaaacgggcgagtctcattgcaggcattgtggtg
ttgtcgctggcggcgcttggcctcggcggctacgcggccatcgtgattgtgacgaggctt
ctcaccgtgccgaacgtggaactgccgtccgtcgtcgggaagccggtggcctcggccgtg
gccacgctggaggcagcaggtttttctaggcaacagattcaggagaagtttgagcccaat
ctgaaggctgcatctgggattgtgtatcagcagtcacccgcgggcaacacccaggtgaag
aagacgcgagacatcacgctctacgtcagccagggcgcgccgaaggtggcggttccggac
gtgaccaatgagccgctggatcaggccaagcaggcgctcgtgagcgccggattttcagcc
aacaacattgtcgttcagacggagacgagcacttctgtgccgtcgggggacgtgatctcg
agcaatccggcgcctgggacgcaggttcccatcacgtcgaagatcaccctcacggtgagc
cagcagcaatacgtcacggtgccgaaactcgtggggcttacacttcaacaggcggaggcg
gccattcaagcggcgggcctcaccttgggcaccgtgacgccgagcgatctcgtcaaccag
aatccgctcgtttcctatgcgtacccgtatatccagggggatcgcgtgcccgtcggatcg
accatcaatctgtatgtcgtgccgaaccctgcctccatcccgccgtctaatgggacgggg
aacgacacaggcaacgcggcgaacggcggatcgcaaaacgacctcggaaacgcggcaggg
gtgggcaatggcagtaccaacagcgcggccggcgacagttccgcgggggataccggaaac
gctacccaacccacggcccagtcagcgccccaaccgcagccgccaggcaaagcggcgcct
ggtcatctgaagcataaagggcattga

DBGET integrated database retrieval system