KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_1493Help
Entry
TC41_1493         CDS       T01821                                 

Gene name
nrdA
Definition
(GenBank) ribonucleoside-diphosphate reductase, alpha subunit
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00230  Purine metabolism
aad00240  Pyrimidine metabolism
aad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    TC41_1493 (nrdA)
   00240 Pyrimidine metabolism
    TC41_1493 (nrdA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aad03400]
    TC41_1493 (nrdA)
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     TC41_1493 (nrdA)
DNA repair and recombination proteins [BR:aad03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    TC41_1493 (nrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN ATP-cone
Motif
Other DBs
NCBI-ProteinID: AEJ43426
UniProt: F8IJA6
LinkDB All DBs
Position
1466485..1468845
Genome map
AA seq 786 aa AA seqDB search
MNAMVHPTDTSTGLMERTSEDERRVGRASHALEEWRDRVKTFTVEKRDGRIEPLSLDKIF
AFLKRGCEAAEGCDPERLAADVWPQLRDGMRTSEIARVAIQAAVEKTSVAEPGWQFVAAR
LLLFDAYKQASRNRGYRHLGYGDFYQLIVELERIGRYGTYIRQHYSEDEIAELAAYIKPE
RDYLFNYVGLKQLLDRYTIRNLDNEIMELPQELFMGVSMHLAMKEKEKVAWAKRFYDMLS
TLQATVATPTLSNARKPFHQLSSCFIDMPEDDLVSIYATDEAFARVSKFGGGMGIYVGKI
RARGSAIRNHPGASGGVVPWIRNFNNTAVSCNQLGMRAGAAAVYLDVWHKDILDFLQLRT
NNGDERMKAHDIFPGVCIPDLFMRRVEERGMWYLFCPYEVRKVMGFSLEDSWGEEFERRY
QACVENPKLPRVEIPAIEIMKRIMQSAFETGTPFIFFRDTANRLNPNKHAGMVYCSNLCT
EIIQNMSPSRRIEETEEGGIITTKTEAGDFVVCNLSSLNLGRCRDLDSIRETVRRQIRAM
DNVIDLNHYPVPQAAVTNRKYRAVGLGVSGYHQYLAEKGIAWESEAHVKHADELFEWINF
FAIEASMELAREKGPYPLFEGSDWQTGRYFDLRGYRTRPGGPDWDGLRRKVAEYGVRNAY
LVAIAPTSSTSLIAGSTAGIDPVYARFFLEEKKNGVVPQTAPNLNDKTFWYYKEAHTIDQ
RWSIEACAARQRHADQSQSFNLYITPGISARQFLDLYLLAWKRGLKTVYYVRSKSVEVED
CVACTS
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgcgatggtacacccaactgacacgtcgacaggactgatggagcggacgagtgag
gatgaacgccgtgtggggcgcgcgagccatgcgctagaggaatggcgcgatcgcgtcaag
accttcacagtggaaaagcgagatgggcggatcgagccgctgtctctggacaaaatcttc
gcatttttaaagcgcggctgcgaagcggccgagggatgcgatccggaacgcctggcggcg
gacgtgtggcctcagctccgggacggcatgcggacgtcggagattgcgcgcgtcgcgatt
caagcggcggtggaaaagacgagcgtcgccgaacccgggtggcagtttgtcgcggctcgg
ttgttgctcttcgatgcgtacaagcaagcgtcgcgcaatcggggttatcgtcatttgggt
tacggggacttttatcagttgattgtcgagctggagcgaatcgggcggtacggcacgtac
atacgacagcactacagcgaggacgagatcgccgaactggccgcctacatcaagccggag
cgagattacctgtttaactacgtgggtctgaagcaactgctggatcggtacaccattcgc
aatctggacaacgagatcatggaactgccgcaagagttgttcatgggcgtgtccatgcac
ctcgccatgaaggaaaaggagaaggtcgcctgggcgaagcgattctacgacatgctgtcc
acgctgcaggccacggtggccacgcccacactgagcaacgcgcgcaaaccgttccaccag
ctgagctcttgcttcatcgacatgccagaggacgatctcgtcagcatctacgccacagac
gaagccttcgcgcgcgtctcgaagttcggcggcgggatgggcatctacgtgggcaagatc
cgggctcgcggatcggccatccgcaatcatccgggggcgtcgggcggcgtggtgccttgg
atccgcaacttcaacaacacggctgtaagctgcaaccaactcggtatgcgagccggcgcg
gcggccgtctacctcgacgtgtggcacaaggacattctggacttcctgcagctgcgcacg
aacaacggcgacgagcggatgaaggcgcacgacatcttcccgggcgtgtgcattccggac
ctcttcatgcggcgcgtagaggagcgcggcatgtggtacctgttctgcccgtacgaggtc
cgcaaggtcatgggcttctcgctggaagacagctggggcgaagagttcgagcggcggtat
caggcgtgcgtggagaatccaaagctgccgcgcgtggagatcccggccatcgaaatcatg
aagcggatcatgcagtccgcgttcgagacgggaacgccgttcatcttcttccgcgacacg
gccaatcgcctcaacccgaacaagcacgcgggcatggtctactgcagcaacttgtgcacg
gagatcattcaaaatatgagcccgtcgcgcagaatcgaagagacggaagagggcgggatc
atcaccacgaagacggaggccggtgatttcgtcgtctgcaacctgtcctcgctgaacctg
gggcggtgccgcgatctcgacagcattcgcgagaccgtgcgccggcagattcgcgcgatg
gacaacgtgatcgacctaaaccattatccggtgccccaggccgccgtcacaaaccgcaag
tatcgggcggtgggcctcggcgtgagcggttatcaccaatatctcgcggagaagggcatc
gcgtgggagtcggaggcccacgtgaaacacgccgacgagctgtttgagtggatcaacttc
tttgccatcgaggcgtccatggagctggcgcgcgaaaaggggccgtatccgctgttcgaa
ggctccgattggcaaaccgggcggtacttcgatctgcgcgggtaccggacgcgcccaggt
ggtccagactgggacggcctgcgccgcaaggtggccgagtacggcgtgcgcaacgcgtat
ctggtggccattgcgccgaccagcagtacgagcctgattgcgggcagcacggcaggcatc
gatcccgtgtacgcgcgctttttcctcgaggagaagaaaaacggcgtcgtacctcagacc
gcgcccaatctgaacgacaagacgttctggtactacaaggaggcgcacaccatcgatcag
cgctggagcatcgaagcgtgcgcggcacggcagcggcacgcggatcagagccaatcgttc
aatctgtacatcacgccaggcatcagcgcacggcagttcctggatctttacctgttggcg
tggaagcgaggcctgaagaccgtgtattacgtccgcagcaaatcggtggaagttgaggat
tgcgtcgcgtgtacgtcatga

DBGET integrated database retrieval system