KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2611Help
Entry
TC41_2611         CDS       T01821                                 

Gene name
gutB
Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad00040  Pentose and glucuronate interconversions
aad00051  Fructose and mannose metabolism
aad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TC41_2611 (gutB)
   00051 Fructose and mannose metabolism
    TC41_2611 (gutB)
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     TC41_2611 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 TP_methylase AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AEJ44506
UniProt: F8II26
LinkDB All DBs
Position
complement(2470543..2471595)
Genome map
AA seq 350 aa AA seqDB search
MSSAIPKTMKAAYLVGTRQVEVREVPVPEPGPDDALIRVEAVGVCGSDVHYYEHGRIGRY
VVDGPLILGHEATGVVVAVGANVKHLRPGQRVAIEPGVTCGRCDFCKSGRYNLCPHVRFL
ATPPVDGAFAQYIAHRADFVHPIPDDMSYEQAAMVEPFSVALHAIRRSGMRPGDRVAIAG
MGPVGLFTVIAARRLGAGDVVVSDTVEKRLQLALQLGATEAVHAKRGAIADAVHERFHEG
VDVAIETAGHPDAVASLLPALRRGGRLVVVGLSQSPLKELDLTQLTDGEIEMAGVFRYAN
TYPAGIQLMREIDVWDLITDTFPLAEAGDALERARTNKSESIKVIVYPQA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgagcgccattcccaagacgatgaaagccgcgtacctcgtcggtacccgacaggtg
gaagtccgcgaggttccggtgcctgagcctgggccggacgacgccttgattcgggtggaa
gcggtcggggtatgcggctccgacgtccactactacgaacacggccggattggcaggtac
gtggtcgacggcccgctcattctgggccacgaggcaacaggcgtcgtcgtggccgtcggc
gcgaacgtgaagcatctgcgtccaggccagcgcgtggccatcgagcccggcgtgacctgc
gggcggtgtgacttttgcaaatcggggcggtacaacctgtgcccgcacgtccgcttcctc
gcgacgccgcccgtcgacggcgcgtttgcccagtacatcgctcaccgcgcggacttcgtc
catcccatcccggacgacatgtcgtacgaacaggcggcgatggtcgagccgttctccgtc
gcgcttcacgccatccgccgatccggcatgcgccctggggatcgcgtcgccatcgctgga
atggggcccgtgggcctcttcacggtgatcgcggcgcggcggctcggcgcgggcgacgtg
gtggtcagcgatacagtggagaagcggcttcaactcgcgcttcagctcggggccacggag
gcggtgcatgcgaagcgcggcgccatcgcggacgcggttcacgagcgtttccatgaaggc
gtcgacgtggccatcgagacggccggccaccccgacgcggtggcctccctcttgccggcg
ctgcgccgcggcgggcggctcgtggtggtgggcctgtcgcagtcgccgctcaaggaactc
gatctgacgcagcttacggacggcgagatcgagatggccggcgtgttccgatacgccaac
acgtatcctgcgggcattcagctcatgcgcgagatcgacgtgtgggacctcatcacggac
acgtttcccctcgcggaggccggggacgccctcgagcgcgcgcggacgaacaagagcgag
agcatcaaggtcatcgtctacccgcaggcgtaa

DBGET integrated database retrieval system