KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2815Help
Entry
TC41_2815         CDS       T01821                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Brite
KEGG Orthology (KO) [BR:aad00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TC41_2815 (ahpF)
Enzymes [BR:aad01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     TC41_2815 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like AlaDh_PNT_C FAD_oxidored DAO FAD_binding_3 K_oxygenase Glutaredoxin Thi4 NAD_binding_8 FMO-like Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AEJ44708
UniProt: F8IJJ5
LinkDB All DBs
Position
complement(2676071..2677600)
Genome map
AA seq 509 aa AA seqDB search
MVLDDDIREQLKQYLELMEGDVVIRVAPGSDDASRDMMELVNELKSMSSKIHVEEADLPR
RPSFSVNRPGEDTGIVFAGAPLGHEFTSLVLALLHVSGRPPKVEESVIRQIQSLEGTYEF
ETYVSLSCHNCPDVVQALNLMSVLNPNIRHTMIDGAVFKSEVEEKNVMAVPTVYLNGEFF
ESGRMSVEDILAKLGSQADVSDLNARDPYDVLVIGGGPAGASAAIYAARKGIRTGIVVDR
FGGQVNDTLGIENFISVKYTEGPTFAAQLEEHVRHYNIDIIKSQRAKQLRKGDLIEVDLE
SGATLRSKTVIIATGARWRNLGVPGEKELQTKGVAYCPHCDGPLFQGKRVAVIGGGNSGV
EAAIDLAGLASHVTVLEFLPQLKADEILQKRLFSLPNVTVLTNVETKEILGTERVTGIRY
ADRATGEEHQLELEGVFVQIGLVPNTEWLGDFVEKTRFGEIVVDSRGQTSVEGVFAAGDC
TNVPYKQIIISMGSGATAALGAFDYLIRH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcgacgatgacattcgagagcaactgaagcagtacctcgagctcatggaaggc
gacgtcgtgatccgggttgcgcccgggtccgacgacgcctcccgcgatatgatggagctc
gtgaacgaattgaaatcgatgtcgtccaagattcacgtggaagaggctgatcttccgcgg
cgcccgagcttcagcgtgaaccgcccaggcgaggacacgggcatcgtgtttgccggcgca
ccgcttggacacgagttcacctcgctggttttggcgctgctccacgtgagtggtcggccg
cccaaggtggaagagtcggtcattcgacaaattcagagcctcgagggcacgtacgaattc
gagacgtacgtcagcctaagttgccacaactgcccggatgtcgtgcaggctctcaacctg
atgagtgtcctgaatccgaacattcggcacaccatgattgacggcgccgtgttcaaatcg
gaagtcgaagagaagaacgtgatggcggtgccgacggtgtatctcaacggggagttcttc
gagagcggtcggatgtcggtggaggacattctcgcgaagctcggcagccaagcggacgtc
tccgacctgaatgcgcgcgatccgtacgacgtcctggtgattggcggcggccccgcgggc
gcgagtgcggccatttacgcggcccgcaagggcattcgaaccggcatcgtggtggaccgg
ttcggcggccaggtgaacgacacgctcggcatcgagaacttcatcagcgtgaaatacacc
gaagggccgacgttcgccgcccagcttgaggaacatgtccgccattacaatatcgacatt
atcaaatctcaacgcgcgaaacaattgcgaaaaggcgatctcatcgaggtcgatctcgaa
agcggtgcgacgctcaggtcgaagacggtcatcatcgcgacaggtgcgcgctggcgcaac
ctgggcgtccctggcgagaaggagttgcagaccaagggcgtggcctactgcccgcactgc
gacggcccgctcttccagggcaagcgcgtggccgtgatcggcggcggcaactctggcgtc
gaggcggccatcgatctcgccgggctcgcgtcgcacgtcaccgtgctcgagtttttgccg
cagctaaaggcagacgagatcttgcaaaagcggctcttcagtctgcccaacgtcacggtg
cttacgaacgtggagacgaaggagatcctcggcacggagcgcgtgacgggcattcgctac
gccgatcgcgccacgggcgaggagcaccagttggagctcgaaggcgtgttcgtgcagatt
ggcctcgtgccgaacacggagtggctcggcgatttcgtcgagaagacgaggttcggtgag
attgtcgtcgatagccgtggccagacgagcgtcgagggcgtgtttgcggcgggcgactgc
accaatgtgccgtacaagcagattatcatctccatgggctccggcgcgaccgccgcgctc
ggcgcgtttgactacctgattcgtcactga

DBGET integrated database retrieval system