KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1: TC41_2856Help
Entry
TC41_2856         CDS       T01821                                 

Gene name
flgK
Definition
(GenBank) flagellar hook-associated protein FlgK
  KO
K02396  flagellar hook-associated protein 1 FlgK
Organism
aad  Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
Pathway
aad02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:aad00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    TC41_2856 (flgK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:aad02035]
    TC41_2856 (flgK)
Bacterial motility proteins [BR:aad02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    TC41_2856 (flgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_bbr_C Flg_bb_rod Myosin_TH1 DASH_Dad3
Motif
Other DBs
NCBI-ProteinID: AEJ44747
UniProt: F8IK41
LinkDB All DBs
Position
complement(2719514..2720941)
Genome map
AA seq 475 aa AA seqDB search
MSGLQAMQEAESVVGNNIDNANTPGYAQESVNLVEGHPYPPVPGDGPMIGGQYGQGVSVQ
SVTRQDSWFYDRQDWQNQSTYQMYSTYSSILTQVQGILSEPSSNGIQNALDQFFGAWQTL
STDPSNTAARQAVITQGQVLAQTANTVTSQLQTLQSNVLSQINDQFQQLEQYAQELSAVQ
AQIAAISQSNVGAGGASSSAVENPNELLDQQAAIIDEMSKLANLTLSQNQDGTISVSIGP
GGSSGTVIPLNALTQASVTEGSNGVLVLRVGSGSNTQTYSLSSVVSGGQIAGNAQGFTEL
TGLLNNLNAFTSQLATQINSALGGQTFFDTSPFGVDVKMTSATLALGPGGPPGSSTYVAG
DNTYAVNVINLQTQAQSITWIDGSGNSQSATGTFDQLLASMVSQVGMTASGVAAGEKTAD
ALLQQSSQLRQSISGVSIDEQASYMIAFQNAYAAAAKYIATFQTMLNALLNMVQP
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgggacttcaggcgatgcaagaggcggaaagtgtggttggcaacaacatcgataac
gccaacacgccgggttacgcgcaggaaagcgtgaatttggtcgaaggccatccgtatccg
ccggtgcctggcgacggcccgatgattggaggccaatacggtcaaggtgtgtcggtgcag
tccgtcactcgtcaggacagttggttctatgaccgccaggactggcagaaccagagtacc
tatcagatgtattcaacgtacagttctatcctcacgcaggtccaaggcattctaagcgaa
ccaagctcgaatgggattcaaaacgcgctcgaccagttcttcggcgcgtggcagacgctc
tccacggatccgtcgaatacggcggcgcgccaggcggtgatcacccaggggcaggtattg
gcgcagaccgcaaacacggtgacgtcgcaactccaaactttgcaatcgaatgttctgagc
caaattaatgatcaatttcagcagctggaacaatatgcgcaagaactttccgcggtgcag
gcacaaattgcagcgatatcgcagagcaacgtgggagcgggtggggcgtcatcgtccgct
gtggaaaacccaaacgagctactcgaccagcaggctgctatcatcgacgaaatgtcgaag
ttggcaaacttaacgctatcgcaaaaccaagatggaaccatatccgtctccatcgggcca
ggcggctcttcgggcacggtgataccgcttaacgcgttgactcaggcgtcggtgacggaa
ggcagcaacggcgtcctcgttctgcgtgtgggttccggctccaatacacagacgtactcg
ctttcgtccgttgtctccggcggacaaattgcgggaaacgcccagggttttacggaactc
acaggtctcttgaacaatttgaatgctttcacgtcccaacttgcgacgcaaattaactcc
gcgctgggcggacagacgttctttgacacgagcccgtttggcgtcgatgtcaagatgacc
agcgcaacgctcgcgctcgggccgggcggtcctcccggatcttccacgtatgtcgcggga
gacaatacgtacgccgtgaatgtcatcaacctgcagacgcaggcgcagtccattacatgg
attgacggcagcggcaattcgcaatccgcgacggggacgttcgatcaactgctcgcaagc
atggtgtctcaagtcggcatgacggcttccggtgtggcggcgggagaaaagacggcagac
gcgcttcttcaacagagctcccaattgcggcagtcgatttcgggggtctcgattgacgag
caggcatcctacatgattgcgtttcaaaatgcgtacgcggctgcggccaaatatatcgcg
acgtttcagacgatgttgaacgccttgttgaacatggttcaaccgtaa

DBGET integrated database retrieval system