KEGG   Aureococcus anophagefferens: AURANDRAFT_26383Help
Entry
AURANDRAFT_26383  CDS       T04134                                 

Definition
(RefSeq) hypothetical protein
Organism
aaf  Aureococcus anophagefferens
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_C_5 GST_C GST_N GST_C_3 GST_N_4 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 20220203
NCBI-ProteinID: XP_009036916
JGI: Auran1_26383
UniProt: F0Y961
LinkDB All DBs
Position
Unknown
AA seq 411 aa AA seqDB search
MWTWKKVAQATSGRVADLAHGPSCAQSRLRLFGASEKDVRVTLFRDHHAWCPYCQKIWLW
LEEKRVPYRVKKVTMFCYGEKEAWYTRVVPSGMLPAVELDGRIVTESDVILERLEATFGP
LVREMNDRDVVACRRLERRLFGAWCEWLCRPQRSAAAEQRSKAQFEAVADAVEDLLARRP
GAFFLGDEFTTADVVFVPYVERMSASLFYYKGFRLRDPAARPRLCAWFDTLETREAYVGT
QSDFHTHCHDLPPQMGGCYESGDAAQAAARDLVDARAGGVPAETTVPVPDDAKLVAAARV
AQFRSQIAAVNGELADAAAVDGALLAAVANLLDGGTAAAPPPGTAAALRYVKDRVNVPRD
MPIHSARALCAALEATAALDSAAVPRSKIRLKDRRDQDPRPFQSAGVRVTA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtggacgtggaagaaggtcgcgcaggcgacgagcggccgcgtcgcggacctggcccac
ggcccgtcctgcgcccagtcgcgcctgcggctcttcggcgcgtcggagaaggacgtgcgc
gtgacgctcttccgcgaccaccacgcctggtgcccctactgccagaagatctggctctgg
ctcgaggagaagcgcgtgccgtaccgcgtcaagaaggtgaccatgttctgctacggggag
aaggaggcgtggtacacgcgcgtcgtgcccagcggcatgctcccggccgtcgagctcgac
gggcgcatcgtcacggagtccgacgtgatcctggaacgtctggaggcgaccttcggcccg
ctcgttcgtgaaatgaacgaccgcgacgtcgtcgcgtgccgccgcctcgagcgccgcctc
ttcggcgcctggtgcgagtggctctgccgcccgcagcggtccgcggctgccgaacagaga
agtaaggcccagttcgaggccgtcgcggacgccgtcgaggacctgctcgcgcggcggccg
ggcgccttcttcctaggcgacgagttcacgaccgcggacgtcgtcttcgtgccctacgtc
gagcgcatgagcgcgtcgctcttctactacaagggcttccggctccgcgacccggccgcg
cggcccaggctctgcgcctggttcgacaccctcgaaacgcgcgaggcctacgtgggcacg
cagtcggacttccacacgcactgccacgacctgccgccccagatgggcggctgctacgag
tccggcgacgcggcccaggccgccgcgcgcgacctcgtcgacgcgcgcgcgggcggcgtc
ccggcggagacgacggtccccgtcccggacgacgcgaaactcgtcgccgccgcgcgcgtc
gcccagttccggtcccagatcgcggcggtcaacggcgagctcgccgacgcggcggccgtg
gacggcgccctgctcgcggccgtggcgaacctcctcgacggcggtacggccgcggcgccg
ccgccgggcacggccgcggcgctccgctacgtgaaggaccgcgtcaacgtgccccgcgac
atgcccatccactcggcgcgcgcgctctgcgcggccctcgaggcgacggcggccctcgac
tccgccgcggtgccgcggtcgaagatccgcctcaaggaccgccgcgaccaggacccgcgg
cccttccagagcgcgggcgtccgcgtgaccgcgtga

DBGET integrated database retrieval system