KEGG   Aureococcus anophagefferens: AURANDRAFT_28007Help
Entry
AURANDRAFT_28007  CDS       T04134                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
aaf  Aureococcus anophagefferens
Pathway
aaf00562  Inositol phosphate metabolism
aaf01100  Metabolic pathways
aaf04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:aaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AURANDRAFT_28007
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    AURANDRAFT_28007
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aaf01009]
    AURANDRAFT_28007
Enzymes [BR:aaf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AURANDRAFT_28007
    3.1.3.48  protein-tyrosine-phosphatase
     AURANDRAFT_28007
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     AURANDRAFT_28007
Protein phosphatases and associated proteins [BR:aaf01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    AURANDRAFT_28007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase3 PTPlike_phytase Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 20220464
NCBI-ProteinID: XP_009038041
JGI: Auran1_28007
UniProt: F0YCA1
LinkDB All DBs
Position
Unknown
AA seq 179 aa AA seqDB search
MQDKVRALVSKKKRRLKEDGFDLDLTYVTPRIIAMGFPASDFEGAYRNDIDDVQRFFDAK
HGGHYKFYNLCSERTYPSDRFHGQFVRFPFDDHNPPPLGLFYFFCKDVEAYLAADPANVV
AIHCKAGKGRTGVMISAYLMWCGDWPDPDEAMKFYGFARTANQKGVTIPSQRRFVDYFS
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacaaggtgcgggccctcgtgtcgaagaagaagcggcgcctcaaagaggacggc
ttcgacctggacctcacctacgtgaccccgcgcatcatcgccatgggctttcccgcgtcg
gacttcgagggcgcctaccgcaacgacatcgacgacgtgcagcgcttcttcgacgcgaag
cacggcggccactacaagttctacaacctctgcagcgagcggacgtacccgagcgaccgc
ttccacggccagttcgtgcgcttccccttcgacgaccacaacccgccgccgttgggcctc
ttctacttcttctgcaaggacgtcgaggcctacctcgccgcggaccccgccaacgtcgtc
gcgatccactgcaaggcgggcaagggccgcacgggcgtcatgatctccgcgtacctcatg
tggtgcggcgactggcccgacccggacgaggccatgaagttctacggcttcgcccgcacg
gcgaaccagaagggcgtgaccatcccgagccagcggcgcttcgtcgactacttctcg

DBGET integrated database retrieval system